Detailed information of oriT
oriT
The information of the oriT region
oriTDB ID | 102507 |
Name | oriT_pECPX221 |
Organism | Escherichia coli strain PX221 |
Sequence Completeness | - |
NCBI accession of oriT (coordinates [strand]) | NZ_JAQQAX010000001 (44568..44620 [-], 53 nt) |
oriT length | 53 nt |
IRs (inverted repeats) | _ |
Location of nic site | _ |
Conserved sequence flanking the nic site |
_ |
Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pECPX221
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure fileT4CP
ID | 1459 | GenBank | WP_015059539 |
Name | t4cp2_PO868_RS00055_pECPX221 | UniProt ID | _ |
Length | 652 a.a. | PDB ID | _ |
Note | Predicted by oriTfinder 2.0 |
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73404.02 Da Isoelectric Point: 9.4339
>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 1687..24517
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO868_RS00005 (PO868_00005) | 1..1035 | - | 1035 | WP_000750512 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
PO868_RS00010 (PO868_00010) | 1048..1683 | - | 636 | WP_000934977 | A24 family peptidase | - |
PO868_RS00015 (PO868_00015) | 1687..2169 | - | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
PO868_RS00020 (PO868_00020) | 2235..2798 | - | 564 | WP_034169414 | type 4 pilus major pilin | - |
PO868_RS00025 (PO868_00025) | 2848..3957 | - | 1110 | WP_000974903 | type II secretion system F family protein | - |
PO868_RS00030 (PO868_00030) | 3948..5486 | - | 1539 | WP_000466225 | ATPase, T2SS/T4P/T4SS family | virB11 |
PO868_RS00035 (PO868_00035) | 5511..6005 | - | 495 | WP_000912553 | type IV pilus biogenesis protein PilP | - |
PO868_RS00040 (PO868_00040) | 5989..7299 | - | 1311 | WP_001454111 | type 4b pilus protein PilO2 | - |
PO868_RS00045 (PO868_00045) | 7350..8993 | - | 1644 | WP_001035592 | PilN family type IVB pilus formation outer membrane protein | - |
PO868_RS00050 (PO868_00050) | 8986..9522 | - | 537 | WP_001220543 | sigma 54-interacting transcriptional regulator | virb4 |
PO868_RS00055 (PO868_00055) | 9569..11527 | - | 1959 | WP_015059539 | type IV secretory system conjugative DNA transfer family protein | - |
PO868_RS00060 (PO868_00060) | 11543..12598 | - | 1056 | WP_001542006 | P-type DNA transfer ATPase VirB11 | virB11 |
PO868_RS00065 (PO868_00065) | 12617..13756 | - | 1140 | WP_034169415 | TrbI/VirB10 family protein | virB10 |
PO868_RS00070 (PO868_00070) | 13746..14447 | - | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | - |
PO868_RS00075 (PO868_00075) | 14513..15247 | - | 735 | WP_000432282 | type IV secretion system protein | virB8 |
PO868_RS00080 (PO868_00085) | 15413..17770 | - | 2358 | WP_272696113 | conjugal transfer protein | virb4 |
PO868_RS00085 (PO868_00090) | 17776..18096 | - | 321 | WP_272696114 | VirB3 family type IV secretion system protein | virB3 |
PO868_RS00090 (PO868_00095) | 18167..18457 | - | 291 | WP_000865479 | conjugal transfer protein | - |
PO868_RS00095 (PO868_00100) | 18457..19041 | - | 585 | WP_001177117 | lytic transglycosylase domain-containing protein | virB1 |
PO868_RS00100 (PO868_00105) | 19062..19460 | - | 399 | WP_001153669 | hypothetical protein | - |
PO868_RS00105 (PO868_00110) | 19579..20016 | - | 438 | WP_034169416 | type IV pilus biogenesis protein PilM | - |
PO868_RS00110 (PO868_00115) | 20022..21257 | - | 1236 | WP_034169417 | toxin co-regulated pilus biosynthesis Q family protein | - |
PO868_RS00115 (PO868_00120) | 21260..21559 | - | 300 | WP_000835763 | TrbM/KikA/MpfK family conjugal transfer protein | - |
PO868_RS00120 (PO868_00125) | 21607..22416 | + | 810 | WP_024237698 | DUF5710 domain-containing protein | - |
PO868_RS00125 (PO868_00130) | 22639..22863 | - | 225 | WP_000713562 | EexN family lipoprotein | - |
PO868_RS00130 (PO868_00135) | 22872..23516 | - | 645 | WP_001310442 | type IV secretion system protein | - |
PO868_RS00135 (PO868_00140) | 23522..24517 | - | 996 | WP_001028540 | type IV secretion system protein | virB6 |
PO868_RS00140 (PO868_00145) | 24521..24778 | - | 258 | WP_000739144 | hypothetical protein | - |
PO868_RS00145 (PO868_00150) | 24775..25077 | - | 303 | WP_001360345 | hypothetical protein | - |
PO868_RS00150 (PO868_00155) | 25058..25315 | - | 258 | WP_001542015 | hypothetical protein | - |
PO868_RS00155 (PO868_00160) | 25348..25794 | - | 447 | WP_001243165 | hypothetical protein | - |
PO868_RS00160 (PO868_00165) | 25805..25975 | - | 171 | WP_000550720 | hypothetical protein | - |
PO868_RS00165 (PO868_00170) | 25979..26422 | - | 444 | WP_000964330 | NfeD family protein | - |
PO868_RS00170 (PO868_00175) | 26796..27749 | - | 954 | WP_072089442 | SPFH domain-containing protein | - |
PO868_RS00175 (PO868_00180) | 27776..27952 | - | 177 | WP_000753050 | hypothetical protein | - |
PO868_RS00180 (PO868_00185) | 27945..28160 | - | 216 | WP_001127357 | DUF1187 family protein | - |
PO868_RS00185 (PO868_00190) | 28153..28605 | - | 453 | WP_000101552 | CaiF/GrlA family transcriptional regulator | - |
Host bacterium
ID | 2951 | GenBank | NZ_JAQQAX010000001 |
Plasmid name | pECPX221 | Incompatibility group | IncI2 |
Plasmid size | 60168 bp | Coordinate of oriT [Strand] | 44568..44620 [-] |
Host baterium | Escherichia coli strain PX221 |
Cargo genes
Drug resistance gene | mcr-1.1 |
Virulence gene | - |
Metal resistance gene | - |
Degradation gene | - |
Symbiosis gene | - |
Anti-CRISPR | - |