Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   102507
Name   oriT_pECPX221 in_silico
Organism   Escherichia coli strain PX221
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_JAQQAX010000001 (44568..44620 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pECPX221
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   1459 GenBank   WP_015059539
Name   t4cp2_PO868_RS00055_pECPX221 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73404.02 Da        Isoelectric Point: 9.4339

>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 1687..24517

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PO868_RS00005 (PO868_00005) 1..1035 - 1035 WP_000750512 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
PO868_RS00010 (PO868_00010) 1048..1683 - 636 WP_000934977 A24 family peptidase -
PO868_RS00015 (PO868_00015) 1687..2169 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
PO868_RS00020 (PO868_00020) 2235..2798 - 564 WP_034169414 type 4 pilus major pilin -
PO868_RS00025 (PO868_00025) 2848..3957 - 1110 WP_000974903 type II secretion system F family protein -
PO868_RS00030 (PO868_00030) 3948..5486 - 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
PO868_RS00035 (PO868_00035) 5511..6005 - 495 WP_000912553 type IV pilus biogenesis protein PilP -
PO868_RS00040 (PO868_00040) 5989..7299 - 1311 WP_001454111 type 4b pilus protein PilO2 -
PO868_RS00045 (PO868_00045) 7350..8993 - 1644 WP_001035592 PilN family type IVB pilus formation outer membrane protein -
PO868_RS00050 (PO868_00050) 8986..9522 - 537 WP_001220543 sigma 54-interacting transcriptional regulator virb4
PO868_RS00055 (PO868_00055) 9569..11527 - 1959 WP_015059539 type IV secretory system conjugative DNA transfer family protein -
PO868_RS00060 (PO868_00060) 11543..12598 - 1056 WP_001542006 P-type DNA transfer ATPase VirB11 virB11
PO868_RS00065 (PO868_00065) 12617..13756 - 1140 WP_034169415 TrbI/VirB10 family protein virB10
PO868_RS00070 (PO868_00070) 13746..14447 - 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
PO868_RS00075 (PO868_00075) 14513..15247 - 735 WP_000432282 type IV secretion system protein virB8
PO868_RS00080 (PO868_00085) 15413..17770 - 2358 WP_272696113 conjugal transfer protein virb4
PO868_RS00085 (PO868_00090) 17776..18096 - 321 WP_272696114 VirB3 family type IV secretion system protein virB3
PO868_RS00090 (PO868_00095) 18167..18457 - 291 WP_000865479 conjugal transfer protein -
PO868_RS00095 (PO868_00100) 18457..19041 - 585 WP_001177117 lytic transglycosylase domain-containing protein virB1
PO868_RS00100 (PO868_00105) 19062..19460 - 399 WP_001153669 hypothetical protein -
PO868_RS00105 (PO868_00110) 19579..20016 - 438 WP_034169416 type IV pilus biogenesis protein PilM -
PO868_RS00110 (PO868_00115) 20022..21257 - 1236 WP_034169417 toxin co-regulated pilus biosynthesis Q family protein -
PO868_RS00115 (PO868_00120) 21260..21559 - 300 WP_000835763 TrbM/KikA/MpfK family conjugal transfer protein -
PO868_RS00120 (PO868_00125) 21607..22416 + 810 WP_024237698 DUF5710 domain-containing protein -
PO868_RS00125 (PO868_00130) 22639..22863 - 225 WP_000713562 EexN family lipoprotein -
PO868_RS00130 (PO868_00135) 22872..23516 - 645 WP_001310442 type IV secretion system protein -
PO868_RS00135 (PO868_00140) 23522..24517 - 996 WP_001028540 type IV secretion system protein virB6
PO868_RS00140 (PO868_00145) 24521..24778 - 258 WP_000739144 hypothetical protein -
PO868_RS00145 (PO868_00150) 24775..25077 - 303 WP_001360345 hypothetical protein -
PO868_RS00150 (PO868_00155) 25058..25315 - 258 WP_001542015 hypothetical protein -
PO868_RS00155 (PO868_00160) 25348..25794 - 447 WP_001243165 hypothetical protein -
PO868_RS00160 (PO868_00165) 25805..25975 - 171 WP_000550720 hypothetical protein -
PO868_RS00165 (PO868_00170) 25979..26422 - 444 WP_000964330 NfeD family protein -
PO868_RS00170 (PO868_00175) 26796..27749 - 954 WP_072089442 SPFH domain-containing protein -
PO868_RS00175 (PO868_00180) 27776..27952 - 177 WP_000753050 hypothetical protein -
PO868_RS00180 (PO868_00185) 27945..28160 - 216 WP_001127357 DUF1187 family protein -
PO868_RS00185 (PO868_00190) 28153..28605 - 453 WP_000101552 CaiF/GrlA family transcriptional regulator -


Host bacterium


ID   2951 GenBank   NZ_JAQQAX010000001
Plasmid name   pECPX221 Incompatibility group   IncI2
Plasmid size   60168 bp Coordinate of oriT [Strand]   44568..44620 [-]
Host baterium   Escherichia coli strain PX221

Cargo genes


Drug resistance gene   mcr-1.1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -