Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   102504
Name   oriT_pCRKP-31_Vir in_silico
Organism   Klebsiella pneumoniae strain CRKP-31
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_JANPXP010000004 (131406..131433 [+], 28 nt)
oriT length   28 nt
IRs (inverted repeats)      16..21, 23..28  (ATCAGA..TCTGAT)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 28 nt

>oriT_pCRKP-31_Vir
AGTTTGGTGCTTATGATCAGAATCTGAT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   1454 GenBank   WP_032438003
Name   traD_NVV53_RS01080_pCRKP-31_Vir insolico UniProt ID   _
Length   708 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 708 a.a.        Molecular weight: 79542.03 Da        Isoelectric Point: 8.6444

>WP_032438003.1 MULTISPECIES: conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MKRRSRNNLHTQEMLYRPALEFRSALILILFSAYVLIDSWTSKYGISEIPFYCSLGLIAMAGWRVWHGVP
VFIAHWRLFHRTMDFLSLEDFRMINNAHFFADDRKYQKLVSLQESGGAPSKKSVYKLLRKKEKIVIPQRT
TFLCNGFKWGPEHSERTYQVHNLSSDMHEVQLPFILNPVTRHYRKLAFDLGGNYAIFGVDKKIPIFVNEE
NFFGHTLITGNVGTGKTVLQRLLSSSMLHLGHIVLVVDPKNDYQWQEGLKEECESLGKPFMHFHAGNPST
SVSYDVSANYVKDTDLSARIMSIISGTEGGEDPFVRIAEGLVTTAIGALKLGGTKPTIQNIYYAIRSKQD
LFVTTRNALRGFYTYHLGADWHLTVQVSPNLTFADEIEKLKEYFHCNYFEDNSPKNMHGMDTVLECFKYI
SGDESHYYKITASLMPMLKRLSQTPMDILLSANDVENPERNIVNSHGLFNSGGVLYISLDGLSDPATARD
LSQLITSDIAAEAGSRYNTASDLSTVPRVSIFIDEAHQAVNMQLINLLAQGRAAKIALFISTQTISDFVS
ATSADTADRLTGLCNNYISTRVTDAKTQELVLTKVGQTNVSMNQVTYTTSAGTKQSHTDFNGSISERKST
TMVNAIPQELLSMIPTLHFIACLQDGRKIVGQMPITVPGKSMRRSTTVFDMVTTSPYKLKMRRNLNVEEI
LSKSQKVG

  Protein domains


Predicted by InterproScan.

(214-261)

(473-655)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 243764..252797

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NVV53_RS02055 (NVV53_02050) 238766..239170 - 405 WP_032437918 hypothetical protein -
NVV53_RS02060 (NVV53_02055) 239145..239603 - 459 WP_004196672 hypothetical protein -
NVV53_RS02065 (NVV53_02060) 240287..241090 + 804 WP_014386512 metallophosphoesterase -
NVV53_RS02070 (NVV53_02065) 241209..242177 + 969 WP_161400566 IS5-like element IS903 family transposase -
NVV53_RS02075 (NVV53_02070) 242254..242862 + 609 WP_232152184 hypothetical protein -
NVV53_RS02080 (NVV53_02075) 242849..243349 + 501 WP_004196661 hypothetical protein -
NVV53_RS02085 (NVV53_02080) 243321..243737 + 417 WP_014386510 hypothetical protein -
NVV53_RS02090 (NVV53_02085) 243764..246487 - 2724 WP_163595835 TraC family protein virb4
NVV53_RS02095 (NVV53_02090) 246532..247269 - 738 WP_004181797 type IV conjugative transfer system lipoprotein TraV traV
NVV53_RS02100 (NVV53_02095) 247279..248130 - 852 WP_025368610 disulfide isomerase -
NVV53_RS02105 (NVV53_02100) 248133..248597 - 465 WP_004181799 hypothetical protein -
NVV53_RS02110 (NVV53_02105) 248600..249970 - 1371 WP_032437928 TrbI/VirB10 family protein traB
NVV53_RS02115 (NVV53_02110) 249930..250448 - 519 WP_014386508 hypothetical protein -
NVV53_RS02120 (NVV53_02115) 250445..251614 - 1170 WP_004026506 type-F conjugative transfer system secretin TraK traK
NVV53_RS02125 (NVV53_02120) 251616..252476 - 861 WP_004196647 TraE/TraK family type IV conjugative transfer system protein traE
NVV53_RS02130 (NVV53_02125) 252495..252797 - 303 WP_024198097 type IV conjugative transfer system protein TraL traL
NVV53_RS02135 (NVV53_02130) 252899..253267 - 369 WP_004026504 hypothetical protein -
NVV53_RS02140 (NVV53_02135) 254083..254397 + 315 WP_032437932 hypothetical protein -
NVV53_RS02145 (NVV53_02140) 254542..255210 + 669 WP_014386506 hypothetical protein -
NVV53_RS02150 (NVV53_02145) 255266..256030 + 765 WP_070083074 hypothetical protein -
NVV53_RS02155 (NVV53_02150) 256158..257336 + 1179 WP_004196657 hypothetical protein -
NVV53_RS02160 (NVV53_02155) 257378..257506 + 129 WP_004196653 hypothetical protein -


Host bacterium


ID   2948 GenBank   NZ_JANPXP010000004
Plasmid name   pCRKP-31_Vir Incompatibility group   IncFIB
Plasmid size   291810 bp Coordinate of oriT [Strand]   131406..131433 [+]
Host baterium   Klebsiella pneumoniae strain CRKP-31

Cargo genes


Drug resistance gene   mph(E), msr(E), armA, sul1, blaDHA-1, qnrB4
Virulence gene   iucA, iucB, iucC, iutA, rmpA
Metal resistance gene   terE, terD, terC, terB, terA, terZ, terW, merR, merT, merP, merC
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -