Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   102496
Name   oriT_pCRKP-06_KPC in_silico
Organism   Klebsiella pneumoniae strain CRKP06
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_JANPYK010000003 (13500..13623 [-], 124 nt)
oriT length   124 nt
IRs (inverted repeats)      101..106, 119..124  (TTTAAT..ATTAAA)
 91..99, 113..121  (AATAATGTA..TACATTATT)
 90..95, 107..112  (AAATAA..TTATTT)
 39..46, 49..56  (GCAAAAAC..GTTTTTGC)
 3..10, 15..22  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 124 nt

>oriT_pCRKP-06_KPC
GGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTGCTTTTTGAATCATTAGCTTATGTTTTAAATAATGTATTTTAATTTATTTTACATTATTAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   1448 GenBank   WP_015059012
Name   traC_NRK84_RS26805_pCRKP-06_KPC insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99393.22 Da        Isoelectric Point: 6.3465

>WP_015059012.1 MULTISPECIES: type IV secretion system protein TraC [Gammaproteobacteria]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGVPFCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMNAAA
TQFPLPEGMNLPLTLRHYRVFFSYCSPSKKKSRADILEMENLVKIIRASLQGASITTQAVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNMADNYSNLLNPEMSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFKGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKKKQARIDDVVDFLKNARDNDQYVESPTIRSRLDEMIVLLDQYT
ANGTYGRYFNSDEPSLRDDARMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNRKVGEFIQKGYRTCRRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

Family of unknown function (DUF5934) (DUF5934)

(290-446)

TraG P-loop domain (P-loop_TraG)

(467-771)

TraC protein (TraC_F_IV)

(38-276)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 1552..14195

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NRK84_RS26775 (NRK84_26775) 1..606 - 606 Protein_0 type-F conjugative transfer system pilin assembly protein TrbC -
NRK84_RS26780 (NRK84_26780) 633..1154 - 522 WP_015059014 hypothetical protein -
NRK84_RS26785 (NRK84_26785) 1217..1525 - 309 WP_000412447 hypothetical protein -
NRK84_RS26790 (NRK84_26790) 1552..2544 - 993 WP_000830838 conjugal transfer pilus assembly protein TraU traU
NRK84_RS26795 (NRK84_26795) 2541..3173 - 633 WP_001203735 type-F conjugative transfer system protein TraW traW
NRK84_RS26800 (NRK84_26800) 3170..3556 - 387 WP_015059013 type-F conjugative transfer system protein TrbI -
NRK84_RS26805 (NRK84_26805) 3553..6180 - 2628 WP_015059012 type IV secretion system protein TraC virb4
NRK84_RS26810 (NRK84_26810) 6340..6561 - 222 WP_001278692 conjugal transfer protein TraR -
NRK84_RS26815 (NRK84_26815) 6696..7211 - 516 WP_062955122 type IV conjugative transfer system lipoprotein TraV traV
NRK84_RS26820 (NRK84_26820) 7208..7459 - 252 WP_001038341 conjugal transfer protein TrbG -
NRK84_RS26825 (NRK84_26825) 7471..7668 - 198 WP_001324648 conjugal transfer protein TrbD -
NRK84_RS26830 (NRK84_26830) 7655..8245 - 591 WP_000002778 conjugal transfer pilus-stabilizing protein TraP -
NRK84_RS26835 (NRK84_26835) 8235..9662 - 1428 WP_032297072 F-type conjugal transfer pilus assembly protein TraB traB
NRK84_RS26840 (NRK84_26840) 9662..10390 - 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
NRK84_RS26845 (NRK84_26845) 10377..10943 - 567 WP_000399794 type IV conjugative transfer system protein TraE traE
NRK84_RS26850 (NRK84_26850) 10965..11276 - 312 WP_000012106 type IV conjugative transfer system protein TraL traL
NRK84_RS26855 (NRK84_26855) 11291..11656 - 366 WP_021519752 type IV conjugative transfer system pilin TraA -
NRK84_RS26860 (NRK84_26860) 11690..11917 - 228 WP_001254386 conjugal transfer relaxosome protein TraY -
NRK84_RS26865 (NRK84_26865) 12011..12697 - 687 WP_015059009 PAS domain-containing protein -
NRK84_RS26870 (NRK84_26870) 12888..13271 - 384 WP_000124981 conjugal transfer relaxosome DNA-binding protein TraM -
NRK84_RS26875 (NRK84_26875) 13548..14195 + 648 WP_015059008 transglycosylase SLT domain-containing protein virB1
NRK84_RS26880 (NRK84_26880) 14492..15313 - 822 WP_001234445 DUF932 domain-containing protein -
NRK84_RS26885 (NRK84_26885) 15424..15720 - 297 WP_001272251 hypothetical protein -
NRK84_RS26890 (NRK84_26890) 16020..16316 + 297 Protein_23 hypothetical protein -
NRK84_RS26895 (NRK84_26895) 16635..16760 - 126 WP_001372321 type I toxin-antitoxin system Hok family toxin -
NRK84_RS26900 (NRK84_26900) 16702..16851 - 150 Protein_25 plasmid maintenance protein Mok -
NRK84_RS26905 (NRK84_26905) 17073..17792 - 720 WP_001276217 plasmid SOS inhibition protein A -
NRK84_RS26910 (NRK84_26910) 17789..18223 - 435 WP_000845953 conjugation system SOS inhibitor PsiB -

Host bacterium

ID   2940 GenBank   NZ_JANPYK010000003
Plasmid name   pCRKP-06_KPC Incompatibility group   IncFIA
Plasmid size   54799 bp Coordinate of oriT [Strand]   13500..13623 [-]
Host baterium   Klebsiella pneumoniae strain CRKP06

Cargo genes

Drug resistance gene   blaKPC-2
Virulence gene   -
Metal resistance gene   merR, merT, merP, merA, merD, merE
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -