Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   102484
Name   oriT_INSLA289|unnamed INSLA289_contig_122 in_silico
Organism   Escherichia coli strain INSLA289
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_LHAT01000122 (16298..16383 [+], 86 nt)
oriT length   86 nt
IRs (inverted repeats)      61..68, 73..80  (TTGGTGGT..ACCACCAA)
 27..34, 37..44  (GCAAAAAC..GTTTTTGC)
 8..13, 21..26  (TGATTT..AAATCA)
Location of nic site      53..54
Conserved sequence flanking the
  nic site    		  GGTGTGGTGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 86 nt

>oriT_INSLA289|unnamed INSLA289_contig_122
AATTACATGATTTAAAACACAAATCAGCAAAAACTTGTTTTTGCGTGGGGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   1440 GenBank   WP_001064245
Name   traC_AKG99_RS25695_INSLA289|unnamed INSLA289_contig_122 insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99159.81 Da        Isoelectric Point: 5.8486

>WP_001064245.1 MULTISPECIES: type IV secretion system protein TraC [Enterobacteriaceae]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAAA
TQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASITTQTVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNVADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAESPTIRSRLDEMIVLLDQYT
ANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

Family of unknown function (DUF5934) (DUF5934)

(289-446)

TraC protein (TraC_F_IV)

(38-276)

TraG P-loop domain (P-loop_TraG)

(467-771)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 714..16951

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AKG99_RS25650 (AKG99_25735) 74..349 + 276 WP_001513501 hypothetical protein -
AKG99_RS25655 (AKG99_25740) 351..698 - 348 WP_001287907 conjugal transfer protein TrbA -
AKG99_RS25660 (AKG99_25745) 714..1457 - 744 WP_001030378 type-F conjugative transfer system pilin assembly protein TraF traF
AKG99_RS25665 (AKG99_25750) 1450..1707 - 258 WP_000864318 conjugal transfer protein TrbE -
AKG99_RS25670 (AKG99_25755) 1734..3542 - 1809 WP_021525552 type-F conjugative transfer system mating-pair stabilization protein TraN traN
AKG99_RS25675 (AKG99_25760) 3539..4177 - 639 WP_000777703 type-F conjugative transfer system pilin assembly protein TrbC trbC
AKG99_RS25680 (AKG99_25765) 4186..5178 - 993 WP_000830183 conjugal transfer pilus assembly protein TraU traU
AKG99_RS25685 (AKG99_25770) 5175..5807 - 633 WP_001203720 type-F conjugative transfer system protein TraW traW
AKG99_RS25690 (AKG99_25775) 5804..6190 - 387 WP_000099688 type-F conjugative transfer system protein TrbI -
AKG99_RS25695 (AKG99_25780) 6187..8814 - 2628 WP_001064245 type IV secretion system protein TraC virb4
AKG99_RS30685 (AKG99_25785) 8974..9195 - 222 WP_001278692 conjugal transfer protein TraR -
AKG99_RS25700 (AKG99_25790) 9330..9845 - 516 WP_000809838 type IV conjugative transfer system lipoprotein TraV traV
AKG99_RS25705 (AKG99_25795) 9842..10093 - 252 WP_001038342 conjugal transfer protein TrbG -
AKG99_RS25710 (AKG99_25800) 10086..10406 - 321 WP_001057287 conjugal transfer protein TrbD virb4
AKG99_RS25715 (AKG99_25805) 10393..10983 - 591 WP_000002787 conjugal transfer pilus-stabilizing protein TraP -
AKG99_RS25720 (AKG99_25810) 10973..12400 - 1428 WP_015387387 F-type conjugal transfer pilus assembly protein TraB traB
AKG99_RS25725 (AKG99_25815) 12400..13128 - 729 WP_001230813 type-F conjugative transfer system secretin TraK traK
AKG99_RS25730 (AKG99_25820) 13115..13681 - 567 WP_000399790 type IV conjugative transfer system protein TraE traE
AKG99_RS25735 (AKG99_25825) 13703..14014 - 312 WP_000012106 type IV conjugative transfer system protein TraL traL
AKG99_RS25740 (AKG99_25830) 14029..14394 - 366 WP_000340282 type IV conjugative transfer system pilin TraA -
AKG99_RS30690 14437..14652 - 216 WP_001352842 conjugal transfer relaxosome protein TraY -
AKG99_RS25745 (AKG99_25835) 14788..15435 - 648 WP_015387377 conjugal transfer transcriptional regulator TraJ -
AKG99_RS25750 (AKG99_25840) 15626..16009 - 384 WP_001063020 conjugal transfer relaxosome DNA-binding protein TraM -
AKG99_RS25755 (AKG99_25845) 16349..16951 + 603 WP_000243701 transglycosylase SLT domain-containing protein virB1
AKG99_RS25760 (AKG99_25850) 17236..18057 - 822 WP_039023648 DUF932 domain-containing protein -
AKG99_RS25765 (AKG99_25855) 18176..18462 - 287 Protein_25 hypothetical protein -
AKG99_RS32855 (AKG99_25860) 18487..18693 - 207 WP_052908621 hypothetical protein -
AKG99_RS33590 18763..18903 + 141 Protein_27 hypothetical protein -

Host bacterium

ID   2928 GenBank   NZ_LHAT01000122
Plasmid name   INSLA289|unnamed INSLA289_contig_122 Incompatibility group   -
Plasmid size   18903 bp Coordinate of oriT [Strand]   16298..16383 [+]
Host baterium   Escherichia coli strain INSLA289

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -