Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   102474
Name   oriT_pT22 in_silico
Organism   Escherichia coli O157:H43 str. T22
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_AHZD02000022 (23062..23185 [+], 124 nt)
oriT length   124 nt
IRs (inverted repeats)      101..106, 119..124  (TTTAAT..ATTAAA)
 91..99, 113..121  (AATAATGTA..TACATTATT)
 90..95, 107..112  (AAATAA..TTATTT)
 57..62, 70..75  (TGATTT..AAATCA)
 41..48, 61..68  (AAAAACAA..TTGTTTTT)
 39..46, 49..56  (GCAAAAAC..GTTTTTGC)
 3..10, 15..22  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 124 nt

>oriT_pT22
GGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTGTTTTTTAAATCATTAGTTTATGTTCTAAATAATGTATTTTAATTTATTTTACATTATTAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   1434 GenBank   WP_001064245
Name   traC_T22_RS03090_pT22 insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99159.81 Da        Isoelectric Point: 5.8486

>WP_001064245.1 MULTISPECIES: type IV secretion system protein TraC [Enterobacteriaceae]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAAA
TQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASITTQTVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNVADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAESPTIRSRLDEMIVLLDQYT
ANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

Family of unknown function (DUF5934) (DUF5934)

(289-446)

TraC protein (TraC_F_IV)

(38-276)

TraG P-loop domain (P-loop_TraG)

(467-771)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 22490..42162

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
T22_RS03185 (T22_021421) 17697..18089 + 393 WP_000272016 plasmid partitioning/stability family protein -
T22_RS03180 (T22_021426) 18173..18352 - 180 WP_000618107 hypothetical protein -
T22_RS03175 (T22_021431) 18513..18920 + 408 WP_001261250 conjugation system SOS inhibitor PsiB -
T22_RS0224780 18917..19679 + 763 Protein_24 plasmid SOS inhibition protein A -
T22_RS28885 (T22_021451) 19852..20004 + 153 Protein_25 DUF5431 family protein -
T22_RS0224785 (T22_021451) 19949..20071 + 123 WP_223720058 Hok/Gef family protein -
T22_RS28530 20364..20658 - 295 Protein_27 hypothetical protein -
T22_RS03170 (T22_021456) 20970..21257 + 288 WP_000107547 hypothetical protein -
T22_RS03165 (T22_021461) 21374..22195 + 822 WP_001234477 DUF932 domain-containing protein -
T22_RS03160 (T22_021466) 22490..23080 - 591 WP_280113963 transglycosylase SLT domain-containing protein virB1
T22_RS03155 (T22_021471) 23426..23809 + 384 WP_000124980 conjugal transfer relaxosome DNA-binding protein TraM -
T22_RS03150 (T22_021476) 23999..24684 + 686 Protein_32 PAS domain-containing protein -
T22_RS03145 (T22_021481) 24778..25005 + 228 WP_001254386 conjugal transfer relaxosome protein TraY -
T22_RS03140 (T22_021486) 25039..25404 + 366 WP_000340267 type IV conjugative transfer system pilin TraA -
T22_RS03135 (T22_021491) 25419..25730 + 312 WP_000012110 type IV conjugative transfer system protein TraL traL
T22_RS03130 (T22_021496) 25752..26318 + 567 WP_000399792 type IV conjugative transfer system protein TraE traE
T22_RS03125 (T22_021501) 26305..27033 + 729 WP_001230810 type-F conjugative transfer system secretin TraK traK
T22_RS03120 (T22_021506) 27033..28460 + 1428 WP_000146689 F-type conjugal transfer pilus assembly protein TraB traB
T22_RS03115 (T22_021511) 28450..29040 + 591 WP_000002791 conjugal transfer pilus-stabilizing protein TraP -
T22_RS03110 (T22_021516) 29027..29224 + 198 WP_001324648 conjugal transfer protein TrbD -
T22_RS03105 (T22_021521) 29236..29487 + 252 WP_001038342 conjugal transfer protein TrbG -
T22_RS03100 (T22_021526) 29484..29999 + 516 WP_000809906 type IV conjugative transfer system lipoprotein TraV traV
T22_RS26715 (T22_021531) 30134..30355 + 222 WP_001278689 conjugal transfer protein TraR -
T22_RS03090 (T22_021536) 30515..33142 + 2628 WP_001064245 type IV secretion system protein TraC virb4
T22_RS03085 (T22_021541) 33139..33525 + 387 WP_000099690 type-F conjugative transfer system protein TrbI -
T22_RS03080 (T22_021546) 33522..34154 + 633 WP_001203716 type-F conjugative transfer system protein TraW traW
T22_RS03075 (T22_021551) 34151..35143 + 993 WP_000830186 conjugal transfer pilus assembly protein TraU traU
T22_RS03070 (T22_021556) 35152..35790 + 639 WP_001406992 type-F conjugative transfer system pilin assembly protein TrbC trbC
T22_RS03065 (T22_021561) 35787..37595 + 1809 WP_000821074 type-F conjugative transfer system mating-pair stabilization protein TraN traN
T22_RS03060 (T22_021566) 37622..37879 + 258 WP_000864346 conjugal transfer protein TrbE -
T22_RS03055 (T22_021571) 37872..38615 + 744 WP_001030388 type-F conjugative transfer system pilin assembly protein TraF traF
T22_RS03050 (T22_021576) 38631..38978 + 348 WP_001287678 conjugal transfer protein TrbA -
T22_RS26720 38980..39255 - 276 WP_001513501 hypothetical protein -
T22_RS03045 (T22_021581) 39336..39620 + 285 WP_000624103 type-F conjugative transfer system pilin chaperone TraQ -
T22_RS03040 (T22_021586) 39607..40152 + 546 WP_000059833 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
T22_RS03035 (T22_021591) 40082..40423 + 342 WP_001406994 P-type conjugative transfer protein TrbJ -
T22_RS03030 (T22_021596) 40410..40802 + 393 WP_001208952 F-type conjugal transfer protein TrbF -
T22_RS03025 (T22_021601) 40789..42162 + 1374 WP_000944319 conjugal transfer pilus assembly protein TraH traH
T22_RS0224800 42159..44976 + 2818 Protein_59 conjugal transfer mating-pair stabilization protein TraG -
T22_RS26725 (T22_021616) 45009..45530 + 522 WP_000632670 conjugal transfer entry exclusion protein TraS -
T22_RS03015 (T22_021621) 45555..46286 + 732 WP_000850422 conjugal transfer complement resistance protein TraT -

Host bacterium

ID   2918 GenBank   NZ_AHZD02000022
Plasmid name   pT22 Incompatibility group   IncFIB
Plasmid size   72279 bp Coordinate of oriT [Strand]   23062..23185 [+]
Host baterium   Escherichia coli O157:H43 str. T22

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -