Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   102437
Name   oriT_p45182_KPC in_silico
Organism   Klebsiella michiganensis strain KO45182
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_JAFIQE010000010 (6580..6655 [-], 76 nt)
oriT length   76 nt
IRs (inverted repeats)      31..38, 41..48  (AGCGTGAT..ATCACGCT)
 17..23, 35..41  (TAAATCA..TGATTTA)
Location of nic site      59..60
Conserved sequence flanking the
  nic site    		  GGTGTATAGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 76 nt

>oriT_p45182_KPC
TTTGTTTTTTTTCTTTTAAATCAGTGCGATAGCGTGATTTATCACGCTGCGTTAGGTGTATAGCCGTTAAGGGATA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   1823 GenBank   WP_000130000
Name   Replic_Relax_JYQ94_RS31845_p45182_KPC insolico UniProt ID   R4WML4
Length   101 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 101 a.a.        Molecular weight: 11477.11 Da        Isoelectric Point: 7.5204

>WP_000130000.1 MULTISPECIES: PadR family transcriptional regulator [Pseudomonadota]
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG

  Protein domains


Predicted by InterproScan.

Transcriptional regulator PadR-like family (PadR)

(15-84)


  Protein structure


Source ID Structure
AlphaFold DB R4WML4


Host bacterium

ID   2881 GenBank   NZ_JAFIQE010000010
Plasmid name   p45182_KPC Incompatibility group   -
Plasmid size   50582 bp Coordinate of oriT [Strand]   6580..6655 [-]
Host baterium   Klebsiella michiganensis strain KO45182

Cargo genes

Drug resistance gene   aac(6')-Ib-cr, blaOXA-1, catB3, ARR-3, qacE, sul1, mph(A), blaKPC-2, aac(6')-Ib
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -