Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 102433 |
| Name | oriT_KO45182|unnamed1  |
| Organism | Klebsiella michiganensis strain KO45182 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_JAFIQE010000004 (71895..71943 [+], 49 nt) |
| oriT length | 49 nt |
| IRs (inverted repeats) | 6..13, 16..23 (GCAAAATT..AATTTTGC) |
| Location of nic site | 32..33 |
| Conserved sequence flanking the nic site |
TGTGTGGTGA |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 49 nt
>oriT_KO45182|unnamed1
AATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTGTGGTGAG
AATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Auxiliary protein
| ID | 740 | GenBank | WP_020805752 |
| Name | WP_020805752_KO45182|unnamed1 |
UniProt ID | A0A377TIM3 |
| Length | 130 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
Auxiliary protein sequence
Download Length: 130 a.a. Molecular weight: 14772.81 Da Isoelectric Point: 4.5715
>WP_020805752.1 MULTISPECIES: conjugal transfer relaxosome DNA-binding protein TraM [Gammaproteobacteria]
MAKIQVYVNDNVAEKINAIAVQRRAEGAKEKDISYSSIASMLLELGLRVYEAQMERKESGFNQMAFNRAL
LESMVKTQFTVNKVLGIECLSPHVNGNPKWEWSGLIENIRDDVSAVMEKFFPNESEIEDE
MAKIQVYVNDNVAEKINAIAVQRRAEGAKEKDISYSSIASMLLELGLRVYEAQMERKESGFNQMAFNRAL
LESMVKTQFTVNKVLGIECLSPHVNGNPKWEWSGLIENIRDDVSAVMEKFFPNESEIEDE
Protein domains
Predicted by InterproScan.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A377TIM3 |
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 46202..69516
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JYQ94_RS28730 (JYQ94_28730) | 42445..43425 | + | 981 | WP_000019441 | IS5-like element ISKpn26 family transposase | - |
| JYQ94_RS32560 | 43407..43610 | + | 204 | WP_340689737 | hypothetical protein | - |
| JYQ94_RS28740 (JYQ94_28740) | 43844..44533 | - | 690 | WP_074186016 | hypothetical protein | - |
| JYQ94_RS28745 (JYQ94_28745) | 44726..45457 | - | 732 | WP_064392678 | conjugal transfer complement resistance protein TraT | - |
| JYQ94_RS28750 (JYQ94_28750) | 45641..46189 | - | 549 | WP_049164063 | conjugal transfer entry exclusion protein TraS | - |
| JYQ94_RS28755 (JYQ94_28755) | 46202..49051 | - | 2850 | WP_064392671 | conjugal transfer mating-pair stabilization protein TraG | traG |
| JYQ94_RS28760 (JYQ94_28760) | 49051..50430 | - | 1380 | WP_177342655 | conjugal transfer pilus assembly protein TraH | traH |
| JYQ94_RS28765 (JYQ94_28765) | 50408..50851 | - | 444 | WP_020316643 | F-type conjugal transfer protein TrbF | - |
| JYQ94_RS28770 (JYQ94_28770) | 50897..51454 | - | 558 | WP_064392668 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| JYQ94_RS28775 (JYQ94_28775) | 51426..51665 | - | 240 | WP_009309875 | type-F conjugative transfer system pilin chaperone TraQ | - |
| JYQ94_RS28780 (JYQ94_28780) | 51676..52428 | - | 753 | WP_020316647 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| JYQ94_RS28785 (JYQ94_28785) | 52449..52775 | - | 327 | WP_020323521 | hypothetical protein | - |
| JYQ94_RS28790 (JYQ94_28790) | 52786..53013 | - | 228 | WP_012540032 | conjugal transfer protein TrbE | - |
| JYQ94_RS28795 (JYQ94_28795) | 53003..53284 | - | 282 | WP_032419932 | hypothetical protein | - |
| JYQ94_RS28800 (JYQ94_28800) | 53317..55272 | - | 1956 | WP_039698502 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| JYQ94_RS28805 (JYQ94_28805) | 55331..55978 | - | 648 | WP_039698503 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| JYQ94_RS28810 (JYQ94_28810) | 56123..56725 | - | 603 | WP_022631520 | hypothetical protein | - |
| JYQ94_RS28815 (JYQ94_28815) | 57446..57994 | - | 549 | WP_022631518 | hypothetical protein | - |
| JYQ94_RS28820 (JYQ94_28820) | 58009..58992 | - | 984 | WP_223176982 | conjugal transfer pilus assembly protein TraU | traU |
| JYQ94_RS28825 (JYQ94_28825) | 59012..59638 | - | 627 | WP_020314628 | type-F conjugative transfer system protein TraW | traW |
| JYQ94_RS28830 (JYQ94_28830) | 59638..60027 | - | 390 | WP_060446931 | type-F conjugative transfer system protein TrbI | - |
| JYQ94_RS28835 (JYQ94_28835) | 60027..62666 | - | 2640 | WP_060446930 | type IV secretion system protein TraC | virb4 |
| JYQ94_RS28840 (JYQ94_28840) | 62738..63136 | - | 399 | WP_072156904 | hypothetical protein | - |
| JYQ94_RS28845 (JYQ94_28845) | 63144..63434 | - | 291 | WP_039698507 | hypothetical protein | - |
| JYQ94_RS28850 (JYQ94_28850) | 63431..63835 | - | 405 | WP_039698508 | hypothetical protein | - |
| JYQ94_RS28855 (JYQ94_28855) | 63902..64219 | - | 318 | WP_064392786 | hypothetical protein | - |
| JYQ94_RS28860 (JYQ94_28860) | 64220..64438 | - | 219 | WP_074194292 | hypothetical protein | - |
| JYQ94_RS28865 (JYQ94_28865) | 64462..64746 | - | 285 | WP_023316401 | hypothetical protein | - |
| JYQ94_RS28870 (JYQ94_28870) | 64751..65161 | - | 411 | WP_020805613 | hypothetical protein | - |
| JYQ94_RS28875 (JYQ94_28875) | 65293..65862 | - | 570 | WP_023340942 | type IV conjugative transfer system lipoprotein TraV | traV |
| JYQ94_RS28880 (JYQ94_28880) | 65885..66481 | - | 597 | WP_064392784 | conjugal transfer pilus-stabilizing protein TraP | - |
| JYQ94_RS28885 (JYQ94_28885) | 66474..67898 | - | 1425 | WP_064392782 | F-type conjugal transfer pilus assembly protein TraB | traB |
| JYQ94_RS28890 (JYQ94_28890) | 67898..68638 | - | 741 | WP_014386193 | type-F conjugative transfer system secretin TraK | traK |
| JYQ94_RS28895 (JYQ94_28895) | 68625..69191 | - | 567 | WP_016831035 | type IV conjugative transfer system protein TraE | traE |
| JYQ94_RS28900 (JYQ94_28900) | 69211..69516 | - | 306 | WP_004178059 | type IV conjugative transfer system protein TraL | traL |
| JYQ94_RS28905 (JYQ94_28905) | 69530..69898 | - | 369 | WP_020316649 | type IV conjugative transfer system pilin TraA | - |
| JYQ94_RS28910 (JYQ94_28910) | 69967..70167 | - | 201 | WP_048289787 | TraY domain-containing protein | - |
| JYQ94_RS32250 | 70253..70954 | - | 702 | WP_023316396 | hypothetical protein | - |
| JYQ94_RS28920 (JYQ94_28920) | 71192..71584 | - | 393 | WP_020805752 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| JYQ94_RS28925 (JYQ94_28925) | 72088..72495 | + | 408 | WP_020805750 | transglycosylase SLT domain-containing protein | - |
| JYQ94_RS28930 (JYQ94_28930) | 72533..73063 | - | 531 | WP_015632491 | antirestriction protein | - |
Host bacterium
| ID | 2877 | GenBank | NZ_JAFIQE010000004 |
| Plasmid name | KO45182|unnamed1 | Incompatibility group | - |
| Plasmid size | 112215 bp | Coordinate of oriT [Strand] | 71895..71943 [+] |
| Host baterium | Klebsiella michiganensis strain KO45182 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | merD, merA, merP, merT, merR, chrA, ncrA, ncrB, ncrC, ncrY |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | AcrIE9 |