Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   102431
Name   oriT_p51087_KPC in_silico
Organism   Morganella morganii strain MM51087
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_JAFIQH010000005 (5075..5173 [-], 99 nt)
oriT length   99 nt
IRs (inverted repeats)      77..82, 89..94  (AAAAAA..TTTTTT)
 77..82, 88..93  (AAAAAA..TTTTTT)
 31..38, 41..48  (AGCGTGAT..ATCACGCT)
 17..23, 35..41  (TAAATCA..TGATTTA)
Location of nic site      59..60
Conserved sequence flanking the
  nic site    		  GGTGTATAGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 99 nt

>oriT_p51087_KPC
TTTGTTTTTTTTCTTTTAAATCAGTGCGATAGCGTGATTTATCACGCTGCGTTAGGTGTATAGCAGGTTAAGGGATAAAAAATCATCTTTTTTTGGTAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   1818 GenBank   WP_000130000
Name   Replic_Relax_JYQ76_RS20655_p51087_KPC insolico UniProt ID   R4WML4
Length   101 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 101 a.a.        Molecular weight: 11477.11 Da        Isoelectric Point: 7.5204

>WP_000130000.1 MULTISPECIES: PadR family transcriptional regulator [Pseudomonadota]
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG

  Protein domains


Predicted by InterproScan.

Transcriptional regulator PadR-like family (PadR)

(15-84)


  Protein structure


Source ID Structure
AlphaFold DB R4WML4


Host bacterium

ID   2875 GenBank   NZ_JAFIQH010000005
Plasmid name   p51087_KPC Incompatibility group   IncR
Plasmid size   54350 bp Coordinate of oriT [Strand]   5075..5173 [-]
Host baterium   Morganella morganii strain MM51087

Cargo genes

Drug resistance gene   catB3, ARR-3, qacE, sul1, mph(A), blaKPC-2, aac(6')-Ib
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -