Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   102429
Name   oriT_SMG008F9|unnamed1 in_silico
Organism   Escherichia coli strain SMG008F9
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_JAKVTD010000020 (49947..50298 [+], 352 nt)
oriT length   352 nt
IRs (inverted repeats)      255..262, 271..278  (ACCGCTAG..CTAGCGGT)
 192..198, 206..212  (TATAAAA..TTTTATA)
 128..134, 148..154  (GCGGTGT..ACACCGC)
 40..47, 50..57  (GCAAAAAC..GTTTTTGC)
 4..11, 16..23  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 352 nt

>oriT_SMG008F9|unnamed1
AGGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTTTCTTTATAAATAGAGAGTTATGAAAAATTAGTTTCTCTTACTCTCTTTATGATATTTAAAAAAGCGGTGTCGGCGCGGCTACAACACCGCGCCGACACCGCTTTGTAGGGGTGGTACTGACTATTTTTATAAAAAACATTATTTTATATTAGGGGTGCTGCTAGCGGCGCGGTGTGTTTTTTTATAGGATACCGCTAGGGGCGCTGCTAGCGGTGCGTCCCTGTTTGCATTATGAATTTTAGTGTTTCGAAATTAACTTTATTTTATGTTCAAAAAAGGTAATCTCTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   1405 GenBank   WP_001064245
Name   traC_ML380_RS17170_SMG008F9|unnamed1 insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99159.81 Da        Isoelectric Point: 5.8486

>WP_001064245.1 MULTISPECIES: type IV secretion system protein TraC [Enterobacteriaceae]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAAA
TQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASITTQTVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNVADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAESPTIRSRLDEMIVLLDQYT
ANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

Family of unknown function (DUF5934) (DUF5934)

(289-446)

TraC protein (TraC_F_IV)

(38-276)

TraG P-loop domain (P-loop_TraG)

(467-771)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 49376..72067

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ML380_RS17040 (ML380_17040) 44831..45064 + 234 WP_000005987 DUF905 family protein -
ML380_RS17045 (ML380_17045) 45092..45289 + 198 Protein_49 hypothetical protein -
ML380_RS17050 (ML380_17050) 45344..45778 + 435 WP_000845936 conjugation system SOS inhibitor PsiB -
ML380_RS17055 (ML380_17055) 45775..46537 + 763 Protein_51 plasmid SOS inhibition protein A -
ML380_RS17060 (ML380_17060) 46506..46694 - 189 WP_001299721 hypothetical protein -
ML380_RS17065 (ML380_17065) 46716..46865 + 150 Protein_53 plasmid maintenance protein Mok -
ML380_RS17070 (ML380_17070) 46807..46932 + 126 WP_001372321 type I toxin-antitoxin system Hok family toxin -
ML380_RS17075 (ML380_17075) 47152..47382 + 231 WP_071586998 hypothetical protein -
ML380_RS17080 (ML380_17080) 47380..47552 - 173 Protein_56 hypothetical protein -
ML380_RS17085 (ML380_17085) 47622..47828 + 207 WP_000547968 hypothetical protein -
ML380_RS17090 (ML380_17090) 47853..48140 + 288 WP_000107535 hypothetical protein -
ML380_RS17095 (ML380_17095) 48258..49079 + 822 WP_001234426 DUF932 domain-containing protein -
ML380_RS17100 (ML380_17100) 49376..49966 - 591 WP_001376243 transglycosylase SLT domain-containing protein virB1
ML380_RS17105 (ML380_17105) 50299..50682 + 384 WP_001151524 conjugal transfer relaxosome DNA-binding protein TraM -
ML380_RS17110 (ML380_17110) 50869..51558 + 690 WP_000283385 conjugal transfer transcriptional regulator TraJ -
ML380_RS17115 (ML380_17115) 51657..52052 + 396 WP_001309237 conjugal transfer relaxosome DNA-bindin protein TraY -
ML380_RS17120 (ML380_17120) 52085..52450 + 366 WP_000994779 type IV conjugative transfer system pilin TraA -
ML380_RS17125 (ML380_17125) 52465..52776 + 312 WP_000012106 type IV conjugative transfer system protein TraL traL
ML380_RS17130 (ML380_17130) 52798..53364 + 567 WP_000399792 type IV conjugative transfer system protein TraE traE
ML380_RS17135 (ML380_17135) 53351..54079 + 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
ML380_RS17140 (ML380_17140) 54079..55506 + 1428 WP_000146685 F-type conjugal transfer pilus assembly protein TraB traB
ML380_RS17145 (ML380_17145) 55496..56086 + 591 WP_001376242 conjugal transfer pilus-stabilizing protein TraP -
ML380_RS17150 (ML380_17150) 56073..56270 + 198 WP_001324648 conjugal transfer protein TrbD -
ML380_RS17155 (ML380_17155) 56282..56533 + 252 WP_001038342 conjugal transfer protein TrbG -
ML380_RS17160 (ML380_17160) 56530..57045 + 516 WP_000809838 type IV conjugative transfer system lipoprotein TraV traV
ML380_RS17165 (ML380_17165) 57180..57401 + 222 WP_001278689 conjugal transfer protein TraR -
ML380_RS17170 (ML380_17170) 57561..60188 + 2628 WP_001064245 type IV secretion system protein TraC virb4
ML380_RS17175 (ML380_17175) 60185..60571 + 387 WP_000099686 type-F conjugative transfer system protein TrbI -
ML380_RS17180 (ML380_17180) 60568..61200 + 633 WP_001203720 type-F conjugative transfer system protein TraW traW
ML380_RS17185 (ML380_17185) 61197..62189 + 993 WP_000830183 conjugal transfer pilus assembly protein TraU traU
ML380_RS17190 (ML380_17190) 62198..62836 + 639 WP_000777700 type-F conjugative transfer system pilin assembly protein TrbC trbC
ML380_RS17195 (ML380_17195) 62833..64641 + 1809 WP_000821841 type-F conjugative transfer system mating-pair stabilization protein TraN traN
ML380_RS17200 (ML380_17200) 64668..64925 + 258 WP_000864318 conjugal transfer protein TrbE -
ML380_RS17205 (ML380_17205) 64918..65661 + 744 WP_001030393 type-F conjugative transfer system pilin assembly protein TraF traF
ML380_RS17210 (ML380_17210) 65677..66024 + 348 WP_001287910 conjugal transfer protein TrbA -
ML380_RS17215 (ML380_17215) 66026..66340 - 315 WP_001324103 hypothetical protein -
ML380_RS17220 (ML380_17220) 66421..66705 + 285 WP_000624109 type-F conjugative transfer system pilin chaperone TraQ -
ML380_RS17225 (ML380_17225) 66692..67237 + 546 WP_000059851 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
ML380_RS17230 (ML380_17230) 67167..67508 + 342 WP_001443031 P-type conjugative transfer protein TrbJ -
ML380_RS17235 (ML380_17235) 67495..67875 + 381 WP_001389370 F-type conjugal transfer protein TrbF -
ML380_RS17240 (ML380_17240) 67875..69248 + 1374 WP_001517790 conjugal transfer pilus assembly protein TraH traH
ML380_RS17245 (ML380_17245) 69245..72067 + 2823 WP_001007018 conjugal transfer mating-pair stabilization protein TraG traG
ML380_RS17250 (ML380_17250) 72083..72580 + 498 WP_000605857 entry exclusion protein -
ML380_RS17255 (ML380_17255) 72612..73343 + 732 WP_023565183 conjugal transfer complement resistance protein TraT -
ML380_RS17260 (ML380_17260) 73596..73709 + 114 WP_242428294 conjugal transfer protein TraD -

Host bacterium

ID   2873 GenBank   NZ_JAKVTD010000020
Plasmid name   SMG008F9|unnamed1 Incompatibility group   IncFIB
Plasmid size   73809 bp Coordinate of oriT [Strand]   49947..50298 [+]
Host baterium   Escherichia coli strain SMG008F9

Cargo genes

Drug resistance gene   sitABCD
Virulence gene   iucA, iucB, iucC, iutA
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -