Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   102425
Name   oriT_SMG008F2|unnamed1 in_silico
Organism   Escherichia coli strain SMG008F2
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_JAKVTC010000027 (23512..23863 [-], 352 nt)
oriT length   352 nt
IRs (inverted repeats)      255..262, 271..278  (ACCGCTAG..CTAGCGGT)
 192..198, 206..212  (TATAAAA..TTTTATA)
 40..47, 50..57  (GCAAAAAC..GTTTTTGC)
 4..11, 16..23  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 352 nt

>oriT_SMG008F2|unnamed1
AGGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTTTCTTTATAAATAGAGAGTTATGAAAAATTAGTTTCTCTTACTCTCTTTATGATATTTAAAAAAGCGGTGTCGGCGCGGCTACAACAACGCGCCGACACCGCTTTGTAGGGGTGGTACTGACTATTTTTATAAAAAACATTATTTTATATTAGGGGTGCTGCTAGCGGCGCGGTGTGTTTTTTTATAGGATACCGCTAGGGGCGCTGCTAGCGGTGCGTCCCTGTTTGCATTATGAATTTTAGTGTTTCGAAATTAACTTTATTTTATGTTCAAAAAAGGTAATCTCTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   1400 GenBank   WP_001064245
Name   traC_ML366_RS18955_SMG008F2|unnamed1 insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99159.81 Da        Isoelectric Point: 5.8486

>WP_001064245.1 MULTISPECIES: type IV secretion system protein TraC [Enterobacteriaceae]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAAA
TQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASITTQTVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNVADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAESPTIRSRLDEMIVLLDQYT
ANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

Family of unknown function (DUF5934) (DUF5934)

(289-446)

TraC protein (TraC_F_IV)

(38-276)

TraG P-loop domain (P-loop_TraG)

(467-771)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 1743..24434

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ML366_RS18865 (ML366_18860) 101..214 - 114 WP_242428294 conjugal transfer protein TraD -
ML366_RS18870 (ML366_18865) 467..1198 - 732 WP_023565183 conjugal transfer complement resistance protein TraT -
ML366_RS18875 (ML366_18870) 1230..1727 - 498 WP_000605857 entry exclusion protein -
ML366_RS18880 (ML366_18875) 1743..4565 - 2823 WP_001007018 conjugal transfer mating-pair stabilization protein TraG traG
ML366_RS18885 (ML366_18880) 4562..5935 - 1374 WP_001517790 conjugal transfer pilus assembly protein TraH traH
ML366_RS18890 (ML366_18885) 5935..6315 - 381 WP_001389370 F-type conjugal transfer protein TrbF -
ML366_RS18895 (ML366_18890) 6302..6643 - 342 WP_001443031 P-type conjugative transfer protein TrbJ -
ML366_RS18900 (ML366_18895) 6573..7118 - 546 WP_000059851 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
ML366_RS18905 (ML366_18900) 7105..7389 - 285 WP_000624109 type-F conjugative transfer system pilin chaperone TraQ -
ML366_RS18910 (ML366_18905) 7470..7784 + 315 WP_001324103 hypothetical protein -
ML366_RS18915 (ML366_18910) 7786..8133 - 348 WP_001287910 conjugal transfer protein TrbA -
ML366_RS18920 (ML366_18915) 8149..8892 - 744 WP_001030393 type-F conjugative transfer system pilin assembly protein TraF traF
ML366_RS18925 (ML366_18920) 8885..9142 - 258 WP_000864318 conjugal transfer protein TrbE -
ML366_RS18930 (ML366_18925) 9169..10977 - 1809 WP_000821841 type-F conjugative transfer system mating-pair stabilization protein TraN traN
ML366_RS18935 (ML366_18930) 10974..11612 - 639 WP_000777700 type-F conjugative transfer system pilin assembly protein TrbC trbC
ML366_RS18940 (ML366_18935) 11621..12613 - 993 WP_000830183 conjugal transfer pilus assembly protein TraU traU
ML366_RS18945 (ML366_18940) 12610..13242 - 633 WP_001203720 type-F conjugative transfer system protein TraW traW
ML366_RS18950 (ML366_18945) 13239..13625 - 387 WP_000099686 type-F conjugative transfer system protein TrbI -
ML366_RS18955 (ML366_18950) 13622..16249 - 2628 WP_001064245 type IV secretion system protein TraC virb4
ML366_RS18960 (ML366_18955) 16409..16630 - 222 WP_001278689 conjugal transfer protein TraR -
ML366_RS18965 (ML366_18960) 16765..17280 - 516 WP_000809838 type IV conjugative transfer system lipoprotein TraV traV
ML366_RS18970 (ML366_18965) 17277..17528 - 252 WP_001038342 conjugal transfer protein TrbG -
ML366_RS18975 (ML366_18970) 17540..17737 - 198 WP_001324648 conjugal transfer protein TrbD -
ML366_RS18980 (ML366_18975) 17724..18314 - 591 WP_001376242 conjugal transfer pilus-stabilizing protein TraP -
ML366_RS18985 (ML366_18980) 18304..19731 - 1428 WP_000146685 F-type conjugal transfer pilus assembly protein TraB traB
ML366_RS18990 (ML366_18985) 19731..20459 - 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
ML366_RS18995 (ML366_18990) 20446..21012 - 567 WP_000399792 type IV conjugative transfer system protein TraE traE
ML366_RS19000 (ML366_18995) 21034..21345 - 312 WP_000012106 type IV conjugative transfer system protein TraL traL
ML366_RS19005 (ML366_19000) 21360..21725 - 366 WP_000994779 type IV conjugative transfer system pilin TraA -
ML366_RS19010 (ML366_19005) 21758..22153 - 396 WP_001309237 conjugal transfer relaxosome DNA-bindin protein TraY -
ML366_RS19015 (ML366_19010) 22252..22941 - 690 WP_000283385 conjugal transfer transcriptional regulator TraJ -
ML366_RS19020 (ML366_19015) 23128..23511 - 384 WP_001151524 conjugal transfer relaxosome DNA-binding protein TraM -
ML366_RS19025 (ML366_19020) 23844..24434 + 591 WP_001376243 transglycosylase SLT domain-containing protein virB1
ML366_RS19030 (ML366_19025) 24731..25552 - 822 WP_001234426 DUF932 domain-containing protein -
ML366_RS19035 (ML366_19030) 25670..25957 - 288 WP_000107535 hypothetical protein -
ML366_RS19040 (ML366_19035) 25982..26188 - 207 WP_000547968 hypothetical protein -
ML366_RS19045 (ML366_19040) 26258..26430 + 173 Protein_36 hypothetical protein -
ML366_RS19050 (ML366_19045) 26428..26658 - 231 WP_071586998 hypothetical protein -
ML366_RS19055 (ML366_19050) 26878..27003 - 126 WP_001372321 type I toxin-antitoxin system Hok family toxin -
ML366_RS19060 (ML366_19055) 26945..27094 - 150 Protein_39 plasmid maintenance protein Mok -
ML366_RS19065 (ML366_19060) 27116..27304 + 189 WP_001299721 hypothetical protein -
ML366_RS19070 (ML366_19065) 27273..28035 - 763 Protein_41 plasmid SOS inhibition protein A -
ML366_RS19075 (ML366_19070) 28032..28466 - 435 WP_000845936 conjugation system SOS inhibitor PsiB -
ML366_RS19080 (ML366_19075) 28521..28718 - 198 Protein_43 hypothetical protein -
ML366_RS19085 (ML366_19080) 28746..28979 - 234 WP_000005987 DUF905 family protein -

Host bacterium

ID   2869 GenBank   NZ_JAKVTC010000027
Plasmid name   SMG008F2|unnamed1 Incompatibility group   IncFIB
Plasmid size   61790 bp Coordinate of oriT [Strand]   23512..23863 [-]
Host baterium   Escherichia coli strain SMG008F2

Cargo genes

Drug resistance gene   sitABCD
Virulence gene   iutA, iucC, iucB, iucA
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -