Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   102414
Name   oriT_SMG001F1|unnamed1 in_silico
Organism   Escherichia coli strain SMG001F1
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_JAKVSL010000025 (27149..27500 [-], 352 nt)
oriT length   352 nt
IRs (inverted repeats)      255..262, 271..278  (ACCGCTAG..CTAGCGGT)
 192..198, 206..212  (TATAAAA..TTTTATA)
 40..46, 51..57  (GCAAAAA..TTTTTGC)
 4..11, 16..23  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 352 nt

>oriT_SMG001F1|unnamed1
AGGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAATTTTTTGCTGATTTTTCTTTATAAATAGAGTGTTATGAAAAATTAGTTTCTCTTACTCTCTTTATGATATTTAAAAAAGCGGTGTCGGCGCGGCTACAACAACGCGCCGACACCGCTTTGTAGGGGTGGTACTGACTATTTTTATAAAAAACATCATTTTATATTAGGGGCGCTGCTAGCGGCGCGGTGTGTTTTTTTATAGGATACCGCTAGGGGCGCTGCTAGCGGTGCGTCCCTGTTTGTATTATGAATTTTAGTGTTCCGAAATTAACTTTATTTTATGTTCAAAAAAGGTAATCTCTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   1390 GenBank   WP_000069771
Name   traC_ML381_RS22605_SMG001F1|unnamed1 insolico UniProt ID   _
Length   876 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 876 a.a.        Molecular weight: 99316.14 Da        Isoelectric Point: 6.4096

>WP_000069771.1 MULTISPECIES: type IV secretion system protein TraC [Enterobacteriaceae]
MSNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAI
PINGANKSIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAA
ATQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASFHGAKITTQTVDAQAFIEIV
GEMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLNVRADYLTLGLRENGRNSTARILNFHLARNPEIAF
LWNMADNYSNLLNPEMSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWG
ELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGK
GLFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFKGMNNTNYNMAVCGTSG
AGKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLS
VMASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAGSPTIRSRLDEMIVLLDQY
TANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRTLKKLNVIDEGW
RLLDFKNRKVGEFIQKGYRTCRRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKY
NQLFPDQFQPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEG
LSIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

(468-768)

(39-277)

(291-447)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 2367..28071

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ML381_RS22490 (ML381_22490) 1..96 + 96 WP_024202152 transposase domain-containing protein -
ML381_RS22495 (ML381_22495) 148..885 - 738 WP_000199901 hypothetical protein -
ML381_RS22500 (ML381_22500) 1088..1819 - 732 WP_000850422 conjugal transfer complement resistance protein TraT -
ML381_RS22505 (ML381_22505) 1851..2348 - 498 WP_000605862 entry exclusion protein -
ML381_RS22510 (ML381_22510) 2367..5186 - 2820 WP_001537571 conjugal transfer mating-pair stabilization protein TraG traG
ML381_RS22515 (ML381_22515) 5183..6556 - 1374 WP_000944331 conjugal transfer pilus assembly protein TraH traH
ML381_RS22520 (ML381_22520) 6543..6935 - 393 WP_000138369 F-type conjugal transfer protein TrbF -
ML381_RS22525 (ML381_22525) 6889..7203 - 315 WP_001336805 P-type conjugative transfer protein TrbJ -
ML381_RS22530 (ML381_22530) 7193..7738 - 546 WP_000059830 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
ML381_RS22535 (ML381_22535) 7725..8009 - 285 WP_000624194 type-F conjugative transfer system pilin chaperone TraQ -
ML381_RS22540 (ML381_22540) 8090..8350 + 261 WP_000736412 hypothetical protein -
ML381_RS22545 (ML381_22545) 8406..8747 - 342 WP_000556795 conjugal transfer protein TrbA -
ML381_RS22550 (ML381_22550) 8761..9504 - 744 WP_001030371 type-F conjugative transfer system pilin assembly protein TraF traF
ML381_RS22555 (ML381_22555) 9497..9754 - 258 WP_000864310 conjugal transfer protein TrbE -
ML381_RS22560 (ML381_22560) 9781..11631 - 1851 WP_000826177 type-F conjugative transfer system mating-pair stabilization protein TraN traN
ML381_RS22565 (ML381_22565) 11628..12050 - 423 WP_001229309 HNH endonuclease signature motif containing protein -
ML381_RS22570 (ML381_22570) 12075..12446 - 372 WP_000174465 hypothetical protein -
ML381_RS22575 (ML381_22575) 12443..13081 - 639 WP_000087539 type-F conjugative transfer system pilin assembly protein TrbC trbC
ML381_RS22580 (ML381_22580) 13108..13626 - 519 WP_000009088 hypothetical protein -
ML381_RS22585 (ML381_22585) 13689..13997 - 309 WP_000412445 hypothetical protein -
ML381_RS22590 (ML381_22590) 14024..15016 - 993 WP_000830838 conjugal transfer pilus assembly protein TraU traU
ML381_RS22595 (ML381_22595) 15013..15645 - 633 WP_001203720 type-F conjugative transfer system protein TraW traW
ML381_RS22600 (ML381_22600) 15642..16028 - 387 WP_000214084 type-F conjugative transfer system protein TrbI -
ML381_RS22605 (ML381_22605) 16025..18655 - 2631 WP_000069771 type IV secretion system protein TraC virb4
ML381_RS27085 18781..18994 - 214 Protein_24 hypothetical protein -
ML381_RS22610 (ML381_22610) 19022..19240 - 219 WP_000556746 hypothetical protein -
ML381_RS22615 (ML381_22615) 19320..19793 - 474 WP_000549566 hypothetical protein -
ML381_RS22620 (ML381_22620) 19786..20199 - 414 WP_000549574 hypothetical protein -
ML381_RS22625 (ML381_22625) 20192..20413 - 222 WP_001278695 conjugal transfer protein TraR -
ML381_RS22630 (ML381_22630) 20548..21063 - 516 WP_000809872 type IV conjugative transfer system lipoprotein TraV traV
ML381_RS22635 (ML381_22635) 21063..21380 - 318 WP_001057297 conjugal transfer protein TrbD -
ML381_RS22640 (ML381_22640) 21367..21933 - 567 WP_000896598 conjugal transfer pilus-stabilizing protein TraP -
ML381_RS22645 (ML381_22645) 21923..23374 - 1452 WP_000146675 F-type conjugal transfer pilus assembly protein TraB traB
ML381_RS22650 (ML381_22650) 23374..24102 - 729 WP_001230767 type-F conjugative transfer system secretin TraK traK
ML381_RS22655 (ML381_22655) 24089..24655 - 567 WP_000399780 type IV conjugative transfer system protein TraE traE
ML381_RS22660 (ML381_22660) 24677..24988 - 312 WP_000012100 type IV conjugative transfer system protein TraL traL
ML381_RS22665 (ML381_22665) 25003..25362 - 360 WP_001099001 type IV conjugative transfer system pilin TraA -
ML381_RS22670 (ML381_22670) 25395..25790 - 396 WP_001309237 conjugal transfer relaxosome DNA-bindin protein TraY -
ML381_RS22675 (ML381_22675) 25889..26578 - 690 WP_000283387 conjugal transfer transcriptional regulator TraJ -
ML381_RS22680 (ML381_22680) 26765..27148 - 384 WP_001151538 conjugal transfer relaxosome DNA-binding protein TraM -
ML381_RS22685 (ML381_22685) 27562..28071 + 510 WP_000759173 transglycosylase SLT domain-containing protein virB1
ML381_RS22690 (ML381_22690) 28368..29189 - 822 WP_001234445 DUF932 domain-containing protein -
ML381_RS22695 (ML381_22695) 29299..29595 - 297 WP_001545326 hypothetical protein -
ML381_RS22700 (ML381_22700) 29895..30191 + 297 Protein_43 hypothetical protein -
ML381_RS22705 (ML381_22705) 30492..30617 - 126 WP_001372321 type I toxin-antitoxin system Hok family toxin -
ML381_RS22710 (ML381_22710) 30559..30708 - 150 Protein_45 plasmid maintenance protein Mok -
ML381_RS22715 (ML381_22715) 30730..30909 + 180 WP_001309233 hypothetical protein -
ML381_RS22720 (ML381_22720) 30887..31649 - 763 Protein_47 plasmid SOS inhibition protein A -
ML381_RS22725 (ML381_22725) 31646..32080 - 435 WP_000845953 conjugation system SOS inhibitor PsiB -


Host bacterium


ID   2858 GenBank   NZ_JAKVSL010000025
Plasmid name   SMG001F1|unnamed1 Incompatibility group   IncFIB
Plasmid size   55855 bp Coordinate of oriT [Strand]   27149..27500 [-]
Host baterium   Escherichia coli strain SMG001F1

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -