Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   102401
Name   oriT_FWSEC0053|unnamed2 in_silico
Organism   Escherichia coli strain FWSEC0053
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_RRDZ01000204 (2727..2812 [-], 86 nt)
oriT length   86 nt
IRs (inverted repeats)      61..68, 73..80  (TTGGTGGT..ACCACCAA)
 27..34, 37..44  (GCAAAAAC..GTTTTTGC)
Location of nic site      53..54
Conserved sequence flanking the
  nic site    		  GGTGTGGTGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 86 nt

>oriT_FWSEC0053|unnamed2
AACTACTTATTTGCAAAGAAAAATCAGCAAAAACTTGTTTTTGCGTGGGGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   1382 GenBank   WP_033800573
Name   traC_C9Z04_RS26970_FWSEC0053|unnamed2 insolico UniProt ID   _
Length   876 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 876 a.a.        Molecular weight: 99536.24 Da        Isoelectric Point: 5.9654

>WP_033800573.1 type IV secretion system protein TraC [Escherichia coli]
MSNNPLEAVTQAVNSLVTALKLPDESAKANEILGEMSFPQFSRLLPYRDYNQESGLFMNDTTLGFMLEAI
PINGANESIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAA
ETQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGAYITTQTVDAQAFIDIV
GEMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAF
LWNMADNYSNLLNPEMSISCPFILTLALVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWG
ELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGK
GLFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSG
AGKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLS
VMASPNGNLDEVHEGLLLQAVRASWLTRQNRARIDDVVDFLKNARDNDQYAESPTIRSRLDEMIVLLDQY
TANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGW
RLLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKY
NQLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEG
LSIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

TraG P-loop domain (P-loop_TraG)

(468-772)

Family of unknown function (DUF5934) (DUF5934)

(291-447)

TraC protein (TraC_F_IV)

(39-277)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 2159..15867

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C9Z04_RS27880 (C9Z04_26895) 1..154 + 154 WP_250208191 single-stranded DNA-binding protein -
C9Z04_RS26875 (C9Z04_26900) 178..480 + 303 WP_001272235 hypothetical protein -
C9Z04_RS26885 (C9Z04_26910) 636..922 + 287 Protein_2 hypothetical protein -
C9Z04_RS26890 (C9Z04_26915) 1041..1862 + 822 WP_074434341 DUF932 domain-containing protein -
C9Z04_RS26895 (C9Z04_26920) 2159..2749 - 591 WP_279600944 transglycosylase SLT domain-containing protein virB1
C9Z04_RS26900 (C9Z04_26925) 3101..3484 + 384 WP_032210979 conjugal transfer relaxosome DNA-binding protein TraM -
C9Z04_RS26905 (C9Z04_26930) 3669..4358 + 690 WP_062873306 conjugal transfer transcriptional regulator TraJ -
C9Z04_RS26910 (C9Z04_26935) 4457..4831 + 375 WP_062874681 conjugal transfer relaxosome DNA-bindin protein TraY -
C9Z04_RS26915 (C9Z04_26940) 4887..5246 + 360 WP_032210977 type IV conjugative transfer system pilin TraA -
C9Z04_RS26920 (C9Z04_26945) 5261..5572 + 312 WP_032210976 type IV conjugative transfer system protein TraL traL
C9Z04_RS26925 (C9Z04_26950) 5594..6160 + 567 WP_000399792 type IV conjugative transfer system protein TraE traE
C9Z04_RS26930 (C9Z04_26955) 6147..6875 + 729 WP_062873307 type-F conjugative transfer system secretin TraK traK
C9Z04_RS26935 (C9Z04_26960) 6875..8329 + 1455 WP_062874676 F-type conjugal transfer pilus assembly protein TraB traB
C9Z04_RS26940 (C9Z04_26965) 8319..8885 + 567 WP_062874677 conjugal transfer pilus-stabilizing protein TraP -
C9Z04_RS26945 (C9Z04_26970) 8824..9096 + 273 WP_032286195 conjugal transfer protein TrbD -
C9Z04_RS26950 (C9Z04_26975) 9093..9608 + 516 WP_044860725 type IV conjugative transfer system lipoprotein TraV traV
C9Z04_RS26955 (C9Z04_26980) 9743..9964 + 222 WP_001278977 conjugal transfer protein TraR -
C9Z04_RS26960 (C9Z04_26985) 9957..10430 + 474 WP_000549599 hypothetical protein -
C9Z04_RS28470 10570..10725 + 156 WP_250208192 hypothetical protein -
C9Z04_RS26965 (C9Z04_26990) 10756..11103 + 348 WP_044860724 hypothetical protein -
C9Z04_RS26970 (C9Z04_26995) 11236..13866 + 2631 WP_033800573 type IV secretion system protein TraC virb4
C9Z04_RS26975 (C9Z04_27000) 13863..14249 + 387 WP_021521305 type-F conjugative transfer system protein TrbI -
C9Z04_RS26980 (C9Z04_27005) 14246..14878 + 633 WP_021521304 type-F conjugative transfer system protein TraW traW
C9Z04_RS26985 (C9Z04_27010) 14875..15867 + 993 WP_032210964 conjugal transfer pilus assembly protein TraU traU

Host bacterium

ID   2845 GenBank   NZ_RRDZ01000204
Plasmid name   FWSEC0053|unnamed2 Incompatibility group   -
Plasmid size   15964 bp Coordinate of oriT [Strand]   2727..2812 [-]
Host baterium   Escherichia coli strain FWSEC0053

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -