Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   102397
Name   oriT_FWSEC0282|unnamed3 in_silico
Organism   Escherichia coli strain FWSEC0282
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_RRJY01000081 (13681..13734 [+], 54 nt)
oriT length   54 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 54 nt

>oriT_FWSEC0282|unnamed3
CACAAGCATTGTAACATGCCCGGAACGGGCTTGTGTACAAAGCTTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   1381 GenBank   WP_000338974
Name   t4cp2_C9069_RS24935_FWSEC0282|unnamed3 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73347.89 Da        Isoelectric Point: 9.1391

>WP_000338974.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 34552..57293

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C9069_RS24805 (C9069_24830) 30463..30915 + 453 WP_000101552 CaiF/GrlA family transcriptional regulator -
C9069_RS24810 (C9069_24835) 30908..31123 + 216 WP_044527566 DUF1187 family protein -
C9069_RS25390 31116..31292 + 177 WP_000753050 hypothetical protein -
C9069_RS24815 (C9069_24840) 31319..32272 + 954 WP_072117112 SPFH domain-containing protein -
C9069_RS24825 (C9069_24850) 32647..33090 + 444 WP_077128227 NfeD family protein -
C9069_RS25395 33094..33264 + 171 WP_000550720 hypothetical protein -
C9069_RS24830 (C9069_24855) 33275..33721 + 447 WP_032349831 hypothetical protein -
C9069_RS24835 (C9069_24860) 33754..34011 + 258 WP_001542015 hypothetical protein -
C9069_RS24840 (C9069_24865) 33992..34294 + 303 WP_001360345 hypothetical protein -
C9069_RS24845 (C9069_24870) 34291..34548 + 258 WP_000739144 hypothetical protein -
C9069_RS24850 (C9069_24875) 34552..35547 + 996 WP_001028543 type IV secretion system protein virB6
C9069_RS24855 (C9069_24880) 35553..36194 + 642 WP_001463086 type IV secretion system protein -
C9069_RS24860 (C9069_24885) 36196..36450 + 255 WP_001043555 EexN family lipoprotein -
C9069_RS24865 (C9069_24890) 36603..37238 + 636 WP_022645136 hypothetical protein -
C9069_RS24870 (C9069_24895) 37410..37697 + 288 WP_050953163 TrbM/KikA/MpfK family conjugal transfer protein -
C9069_RS24875 (C9069_24900) 37700..38956 + 1257 WP_136770274 TcpQ domain-containing protein -
C9069_RS24880 (C9069_24905) 38962..39399 + 438 WP_000539665 type IV pilus biogenesis protein PilM -
C9069_RS24885 (C9069_24910) 39518..39916 + 399 WP_032169042 hypothetical protein -
C9069_RS24890 (C9069_24915) 39937..40521 + 585 WP_001177118 lytic transglycosylase domain-containing protein virB1
C9069_RS25490 40521..40811 + 291 WP_000865478 TrbC/VirB2 family protein virB2
C9069_RS24900 (C9069_24925) 40882..41202 + 321 WP_024247125 VirB3 family type IV secretion system protein virB3
C9069_RS24905 (C9069_24930) 41208..43565 + 2358 WP_136760062 VirB4 family type IV secretion system protein virb4
C9069_RS24910 (C9069_24935) 43597..43731 + 135 WP_000701233 hypothetical protein -
C9069_RS24915 (C9069_24940) 43731..44465 + 735 WP_000432282 type IV secretion system protein virB8
C9069_RS24920 (C9069_24945) 44531..45232 + 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
C9069_RS24925 (C9069_24950) 45222..46361 + 1140 WP_000790641 TrbI/VirB10 family protein virB10
C9069_RS24930 (C9069_24955) 46444..47499 + 1056 WP_001059977 P-type DNA transfer ATPase VirB11 virB11
C9069_RS24935 (C9069_24960) 47515..49473 + 1959 WP_000338974 type IV secretory system conjugative DNA transfer family protein -
C9069_RS24940 (C9069_24965) 49520..50005 + 486 WP_001220538 sigma 54-interacting transcriptional regulator virb4
C9069_RS24945 (C9069_24970) 49998..51641 + 1644 WP_001035585 PilN family type IVB pilus formation outer membrane protein -
C9069_RS24950 (C9069_24975) 51692..53002 + 1311 WP_001454111 type 4b pilus protein PilO2 -
C9069_RS24955 (C9069_24980) 52986..53480 + 495 WP_000912553 type IV pilus biogenesis protein PilP -
C9069_RS24960 (C9069_24985) 53505..55043 + 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
C9069_RS24965 (C9069_24990) 55034..56143 + 1110 WP_000974903 type II secretion system F family protein -
C9069_RS24970 (C9069_24995) 56188..56745 + 558 WP_000095048 type 4 pilus major pilin -
C9069_RS24975 (C9069_25000) 56811..57293 + 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
C9069_RS24980 (C9069_25005) 57297..57932 + 636 WP_000934979 A24 family peptidase -
C9069_RS24985 (C9069_25010) 57945..58979 + 1035 WP_000750512 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -


Host bacterium


ID   2841 GenBank   NZ_RRJY01000081
Plasmid name   FWSEC0282|unnamed3 Incompatibility group   IncI2
Plasmid size   58979 bp Coordinate of oriT [Strand]   13681..13734 [+]
Host baterium   Escherichia coli strain FWSEC0282

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -