Detailed information of oriT
oriT
The information of the oriT region
oriTDB ID | 102397 |
Name | oriT_FWSEC0282|unnamed3 |
Organism | Escherichia coli strain FWSEC0282 |
Sequence Completeness | - |
NCBI accession of oriT (coordinates [strand]) | NZ_RRJY01000081 (13681..13734 [+], 54 nt) |
oriT length | 54 nt |
IRs (inverted repeats) | _ |
Location of nic site | _ |
Conserved sequence flanking the nic site |
_ |
Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 54 nt
>oriT_FWSEC0282|unnamed3
CACAAGCATTGTAACATGCCCGGAACGGGCTTGTGTACAAAGCTTATCGTGCCT
CACAAGCATTGTAACATGCCCGGAACGGGCTTGTGTACAAAGCTTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure fileT4CP
ID | 1381 | GenBank | WP_000338974 |
Name | t4cp2_C9069_RS24935_FWSEC0282|unnamed3 | UniProt ID | _ |
Length | 652 a.a. | PDB ID | _ |
Note | Predicted by oriTfinder 2.0 |
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73347.89 Da Isoelectric Point: 9.1391
>WP_000338974.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 34552..57293
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C9069_RS24805 (C9069_24830) | 30463..30915 | + | 453 | WP_000101552 | CaiF/GrlA family transcriptional regulator | - |
C9069_RS24810 (C9069_24835) | 30908..31123 | + | 216 | WP_044527566 | DUF1187 family protein | - |
C9069_RS25390 | 31116..31292 | + | 177 | WP_000753050 | hypothetical protein | - |
C9069_RS24815 (C9069_24840) | 31319..32272 | + | 954 | WP_072117112 | SPFH domain-containing protein | - |
C9069_RS24825 (C9069_24850) | 32647..33090 | + | 444 | WP_077128227 | NfeD family protein | - |
C9069_RS25395 | 33094..33264 | + | 171 | WP_000550720 | hypothetical protein | - |
C9069_RS24830 (C9069_24855) | 33275..33721 | + | 447 | WP_032349831 | hypothetical protein | - |
C9069_RS24835 (C9069_24860) | 33754..34011 | + | 258 | WP_001542015 | hypothetical protein | - |
C9069_RS24840 (C9069_24865) | 33992..34294 | + | 303 | WP_001360345 | hypothetical protein | - |
C9069_RS24845 (C9069_24870) | 34291..34548 | + | 258 | WP_000739144 | hypothetical protein | - |
C9069_RS24850 (C9069_24875) | 34552..35547 | + | 996 | WP_001028543 | type IV secretion system protein | virB6 |
C9069_RS24855 (C9069_24880) | 35553..36194 | + | 642 | WP_001463086 | type IV secretion system protein | - |
C9069_RS24860 (C9069_24885) | 36196..36450 | + | 255 | WP_001043555 | EexN family lipoprotein | - |
C9069_RS24865 (C9069_24890) | 36603..37238 | + | 636 | WP_022645136 | hypothetical protein | - |
C9069_RS24870 (C9069_24895) | 37410..37697 | + | 288 | WP_050953163 | TrbM/KikA/MpfK family conjugal transfer protein | - |
C9069_RS24875 (C9069_24900) | 37700..38956 | + | 1257 | WP_136770274 | TcpQ domain-containing protein | - |
C9069_RS24880 (C9069_24905) | 38962..39399 | + | 438 | WP_000539665 | type IV pilus biogenesis protein PilM | - |
C9069_RS24885 (C9069_24910) | 39518..39916 | + | 399 | WP_032169042 | hypothetical protein | - |
C9069_RS24890 (C9069_24915) | 39937..40521 | + | 585 | WP_001177118 | lytic transglycosylase domain-containing protein | virB1 |
C9069_RS25490 | 40521..40811 | + | 291 | WP_000865478 | TrbC/VirB2 family protein | virB2 |
C9069_RS24900 (C9069_24925) | 40882..41202 | + | 321 | WP_024247125 | VirB3 family type IV secretion system protein | virB3 |
C9069_RS24905 (C9069_24930) | 41208..43565 | + | 2358 | WP_136760062 | VirB4 family type IV secretion system protein | virb4 |
C9069_RS24910 (C9069_24935) | 43597..43731 | + | 135 | WP_000701233 | hypothetical protein | - |
C9069_RS24915 (C9069_24940) | 43731..44465 | + | 735 | WP_000432282 | type IV secretion system protein | virB8 |
C9069_RS24920 (C9069_24945) | 44531..45232 | + | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | - |
C9069_RS24925 (C9069_24950) | 45222..46361 | + | 1140 | WP_000790641 | TrbI/VirB10 family protein | virB10 |
C9069_RS24930 (C9069_24955) | 46444..47499 | + | 1056 | WP_001059977 | P-type DNA transfer ATPase VirB11 | virB11 |
C9069_RS24935 (C9069_24960) | 47515..49473 | + | 1959 | WP_000338974 | type IV secretory system conjugative DNA transfer family protein | - |
C9069_RS24940 (C9069_24965) | 49520..50005 | + | 486 | WP_001220538 | sigma 54-interacting transcriptional regulator | virb4 |
C9069_RS24945 (C9069_24970) | 49998..51641 | + | 1644 | WP_001035585 | PilN family type IVB pilus formation outer membrane protein | - |
C9069_RS24950 (C9069_24975) | 51692..53002 | + | 1311 | WP_001454111 | type 4b pilus protein PilO2 | - |
C9069_RS24955 (C9069_24980) | 52986..53480 | + | 495 | WP_000912553 | type IV pilus biogenesis protein PilP | - |
C9069_RS24960 (C9069_24985) | 53505..55043 | + | 1539 | WP_000466225 | ATPase, T2SS/T4P/T4SS family | virB11 |
C9069_RS24965 (C9069_24990) | 55034..56143 | + | 1110 | WP_000974903 | type II secretion system F family protein | - |
C9069_RS24970 (C9069_24995) | 56188..56745 | + | 558 | WP_000095048 | type 4 pilus major pilin | - |
C9069_RS24975 (C9069_25000) | 56811..57293 | + | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
C9069_RS24980 (C9069_25005) | 57297..57932 | + | 636 | WP_000934979 | A24 family peptidase | - |
C9069_RS24985 (C9069_25010) | 57945..58979 | + | 1035 | WP_000750512 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
Host bacterium
ID | 2841 | GenBank | NZ_RRJY01000081 |
Plasmid name | FWSEC0282|unnamed3 | Incompatibility group | IncI2 |
Plasmid size | 58979 bp | Coordinate of oriT [Strand] | 13681..13734 [+] |
Host baterium | Escherichia coli strain FWSEC0282 |
Cargo genes
Drug resistance gene | - |
Virulence gene | - |
Metal resistance gene | - |
Degradation gene | - |
Symbiosis gene | - |
Anti-CRISPR | - |