Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   102372
Name   oriT_FWSEC0107|unnamed3 in_silico
Organism   Escherichia coli strain FWSEC0107
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_RRFY01000105 (66646..66769 [-], 124 nt)
oriT length   124 nt
IRs (inverted repeats)      92..99, 113..120  (ATAATGTA..TACATTAT)
 90..95, 107..112  (AAATAA..TTATTT)
 39..46, 49..56  (GCAAAAAC..GTTTTTGC)
 3..10, 15..22  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 124 nt

>oriT_FWSEC0107|unnamed3
GGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTGATATTTGAATCATTAACTTATGTTTTAAATAATGTATTTTAATTTATTTTACATTATAAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein


ID   712 GenBank   WP_032142519
Name   WP_032142519_FWSEC0107|unnamed3 insolico UniProt ID   _
Length   75 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 75 a.a.        Molecular weight: 9106.17 Da        Isoelectric Point: 10.3319

>WP_032142519.1 conjugal transfer relaxosome protein TraY [Escherichia coli]
MRRRNARGGTSRTVSVYLDEDTNNRLIRAKDRSGRSKTIEVQIRLRDHLKRYPDFYNEEIFREVTEERES
TFKEL

  Protein domains


Predicted by InterproScan.

(14-61)


  Protein structure



No available structure.



ID   713 GenBank   WP_001151560
Name   WP_001151560_FWSEC0107|unnamed3 insolico UniProt ID   _
Length   127 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 127 a.a.        Molecular weight: 14518.50 Da        Isoelectric Point: 4.7279

>WP_001151560.1 conjugal transfer relaxosome DNA-binding protein TraM [Escherichia coli]
MAKVQAYVSDEIVYKINEIVERRRAEGAKSTDVSFSSISTMLLELGLRVYEAQMERKESSFNQTEFNKVL
LECVVKTQSSVAKILGIESLSPHIAGNPKFEYANMVEDIREKVSSEMERFFPKNDEE

  Protein domains


Predicted by InterproScan.

(1-126)


  Protein structure



No available structure.




T4CP


ID   1375 GenBank   WP_136797781
Name   traD_C9Z57_RS24075_FWSEC0107|unnamed3 insolico UniProt ID   _
Length   726 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 726 a.a.        Molecular weight: 82538.15 Da        Isoelectric Point: 5.0523

>WP_136797781.1 type IV conjugative transfer system coupling protein TraD [Escherichia coli]
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILVGLVLWVKISWQTFVNGCIYWWCTTLEGMR
DLIRSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLASVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTDNPKDVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYAR
QRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGESFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQARPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPDVPEVVSGEDVTQAEQPQQPQQPQQ
PQQPVSPAINDKKSDAGVNVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAVYEAWQREQNPDIQQ
QMQRREEVNINVHRERGEDVEPGDDF

  Protein domains


Predicted by InterproScan.

(173-560)

(32-128)

  Protein structure



No available structure.



ID   1376 GenBank   WP_136797783
Name   traC_C9Z57_RS24200_FWSEC0107|unnamed3 insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99407.10 Da        Isoelectric Point: 5.5245

>WP_136797783.1 type IV secretion system protein TraC [Escherichia coli]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDSTMGFMLEAIP
INGANETIVEALDHMLRTKLPRGIPLCIHLMSSQLVGERIEYGLREFSWSGEQAERFNAITWAYYMKAAE
TLFPLPEGLNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGAYITTQTVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITVFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFRQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERIRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAESPTIRSRLDEMIVLLDQYT
ANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLFPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRQEGL
SIHEAVWQLAWKKSGPEMASLESWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

(289-446)

(38-276)

(467-770)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 37072..64426

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C9Z57_RS24065 (C9Z57_24100) 36438..36665 + 228 WP_000450527 toxin-antitoxin system antitoxin VapB -
C9Z57_RS24070 (C9Z57_24105) 36665..37063 + 399 WP_000911320 type II toxin-antitoxin system VapC family toxin -
C9Z57_RS24075 (C9Z57_24110) 37072..39252 - 2181 WP_136797781 type IV conjugative transfer system coupling protein TraD virb4
C9Z57_RS24080 (C9Z57_24115) 39309..40040 - 732 WP_000199918 hypothetical protein -
C9Z57_RS24085 (C9Z57_24120) 40216..41004 - 789 WP_033817126 hypothetical protein -
C9Z57_RS24090 (C9Z57_24125) 41172..41483 + 312 WP_000522220 heavy metal-binding domain-containing protein -
C9Z57_RS24095 (C9Z57_24130) 41486..44305 - 2820 WP_033817127 conjugal transfer mating-pair stabilization protein TraG traG
C9Z57_RS24100 (C9Z57_24135) 44302..45675 - 1374 WP_000944332 conjugal transfer pilus assembly protein TraH traH
C9Z57_RS24105 (C9Z57_24140) 45662..46054 - 393 WP_000660704 F-type conjugal transfer protein TrbF -
C9Z57_RS24110 (C9Z57_24145) 46035..46382 - 348 WP_071532380 P-type conjugative transfer protein TrbJ -
C9Z57_RS24115 (C9Z57_24150) 46312..46857 - 546 WP_001457363 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
C9Z57_RS24120 (C9Z57_24155) 46844..47131 - 288 WP_000335420 type-F conjugative transfer system pilin chaperone TraQ -
C9Z57_RS24125 (C9Z57_24160) 47197..47598 - 402 WP_044808433 hypothetical protein -
C9Z57_RS25095 (C9Z57_24165) 47729..48093 - 365 Protein_46 hypothetical protein -
C9Z57_RS24135 (C9Z57_24170) 48107..48850 - 744 WP_001030373 type-F conjugative transfer system pilin assembly protein TraF traF
C9Z57_RS24140 (C9Z57_24175) 48843..49100 - 258 WP_000864346 conjugal transfer protein TrbE -
C9Z57_RS24145 (C9Z57_24180) 49114..51018 - 1905 WP_052079465 type-F conjugative transfer system mating-pair stabilization protein TraN traN
C9Z57_RS24150 (C9Z57_24185) 51112..51492 - 381 WP_032206670 hypothetical protein -
C9Z57_RS24155 (C9Z57_24190) 51489..52127 - 639 WP_001035184 type-F conjugative transfer system pilin assembly protein TrbC trbC
C9Z57_RS24160 (C9Z57_24195) 52411..52689 - 279 WP_001365600 hypothetical protein -
C9Z57_RS24165 (C9Z57_24200) 52716..52865 - 150 Protein_53 TraU family protein -
C9Z57_RS24170 (C9Z57_24205) 52869..53315 - 447 WP_001289131 hypothetical protein -
C9Z57_RS24180 (C9Z57_24215) 54042..54584 - 543 WP_001365589 hypothetical protein -
C9Z57_RS24185 (C9Z57_24220) 54598..55590 - 993 WP_000817328 conjugal transfer pilus assembly protein TraU traU
C9Z57_RS24190 (C9Z57_24225) 55587..56219 - 633 WP_000877291 type-F conjugative transfer system protein TraW traW
C9Z57_RS24195 (C9Z57_24230) 56216..56602 - 387 WP_033817130 type-F conjugative transfer system protein TrbI -
C9Z57_RS24200 (C9Z57_24235) 56599..59226 - 2628 WP_136797783 type IV secretion system protein TraC virb4
C9Z57_RS24205 (C9Z57_24240) 59386..59607 - 222 WP_001278980 conjugal transfer protein TraR -
C9Z57_RS24210 (C9Z57_24245) 59742..60257 - 516 WP_000809868 type IV conjugative transfer system lipoprotein TraV traV
C9Z57_RS24215 (C9Z57_24250) 60254..60505 - 252 WP_001038341 conjugal transfer protein TrbG -
C9Z57_RS24220 (C9Z57_24255) 60498..60818 - 321 WP_001057271 DUF2689 domain-containing protein virb4
C9Z57_RS24225 (C9Z57_24260) 60805..61392 - 588 WP_000002898 conjugal transfer pilus-stabilizing protein TraP -
C9Z57_RS24230 (C9Z57_24265) 61382..62812 - 1431 WP_000146622 F-type conjugal transfer pilus assembly protein TraB traB
C9Z57_RS24235 (C9Z57_24270) 62812..63540 - 729 WP_001365587 type-F conjugative transfer system secretin TraK traK
C9Z57_RS24240 (C9Z57_24275) 63527..64093 - 567 WP_000399759 type IV conjugative transfer system protein TraE traE
C9Z57_RS24245 (C9Z57_24280) 64115..64426 - 312 WP_000012099 type IV conjugative transfer system protein TraL traL
C9Z57_RS24250 (C9Z57_24285) 64441..64794 - 354 WP_021521309 type IV conjugative transfer system pilin TraA -
C9Z57_RS24255 (C9Z57_24290) 64829..65056 - 228 WP_032142519 conjugal transfer relaxosome protein TraY -
C9Z57_RS24260 (C9Z57_24295) 65144..65833 - 690 WP_000332473 PAS domain-containing protein -
C9Z57_RS24265 (C9Z57_24300) 66026..66409 - 384 WP_001151560 conjugal transfer relaxosome DNA-binding protein TraM -
C9Z57_RS24270 (C9Z57_24305) 66694..67341 + 648 WP_135301269 transglycosylase SLT domain-containing protein -
C9Z57_RS24275 (C9Z57_24310) 67637..68458 - 822 WP_052892104 DUF932 domain-containing protein -
C9Z57_RS24280 (C9Z57_24315) 68577..68864 - 288 WP_000107543 hypothetical protein -
C9Z57_RS24290 (C9Z57_24325) 69020..69322 - 303 WP_001272235 hypothetical protein -


Host bacterium


ID   2816 GenBank   NZ_RRFY01000105
Plasmid name   FWSEC0107|unnamed3 Incompatibility group   IncFIC
Plasmid size   69504 bp Coordinate of oriT [Strand]   66646..66769 [-]
Host baterium   Escherichia coli strain FWSEC0107

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -