Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   102367
Name   oriT_FWSEC0120|unnamed2 in_silico
Organism   Escherichia coli strain FWSEC0120
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_RRGL01000079 (45905..46028 [-], 124 nt)
oriT length   124 nt
IRs (inverted repeats)      101..106, 119..124  (TTTAAT..ATTAAA)
 91..99, 113..121  (AATAATGTA..TACATTATT)
 90..95, 107..112  (AAATAA..TTATTT)
 41..48, 61..68  (AAAAACAA..TTGTTTTT)
 39..46, 49..56  (GCAAAAAC..GTTTTTGC)
 3..10, 15..22  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 124 nt

>oriT_FWSEC0120|unnamed2
GGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCCGATTTGTTTTTTAAATCATTAGTTTATGTTCCAAATAATGTATTTTAATTTATTTTACATTATTAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein

ID   710 GenBank   WP_001254388
Name   WP_001254388_FWSEC0120|unnamed2 insolico UniProt ID   W9A0Z2
Length   75 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 75 a.a.        Molecular weight: 9072.20 Da        Isoelectric Point: 10.2071

>WP_001254388.1 MULTISPECIES: conjugal transfer relaxosome protein TraY [Enterobacterales]
MRRRNARGGISRTVSVYLDEDTNNRLIRAKDRSGRSKTIEVQIRLRDHLKRFPDFYNEEIFREVIEENES
TFKEL

  Protein domains


Predicted by InterproScan.

TraY domain (TraY)

(14-61)


  Protein structure


Source ID Structure
AlphaFold DB W9A0Z2

ID   711 GenBank   WP_086217795
Name   WP_086217795_FWSEC0120|unnamed2 insolico UniProt ID   _
Length   127 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 127 a.a.        Molecular weight: 14514.45 Da        Isoelectric Point: 4.7345

>WP_086217795.1 conjugal transfer relaxosome DNA-binding protein TraM [Escherichia coli]
MARVNLYISNEVHEKINMIVEKRRQEGARDKDISLSGTASMLLELGLRVYDAQMERKESAFNQAEFNKVL
LECAVKTQSTVAKILGIESLSPHVSGNPKFEYANMVEDIREKVSSEMERFFPENDED

  Protein domains


Predicted by InterproScan.

TraM protein, DNA-binding (Tra_M)

(1-126)


  Protein structure



No available structure.




T4CP

ID   1373 GenBank   WP_086217781
Name   traD_C9Z70_RS25285_FWSEC0120|unnamed2 insolico UniProt ID   _
Length   732 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 732 a.a.        Molecular weight: 83218.82 Da        Isoelectric Point: 5.0504

>WP_086217781.1 type IV conjugative transfer system coupling protein TraD [Escherichia coli]
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILVGLVLWVKISWQTFVNGCIYWWCTTLEGMR
DLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLATVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTDNPKDVARMLKKDGRDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYAR
QRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCVAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGESFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQARPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPDVPEVVSGEDVTQAEQPQQPQQPQQ
PQQPQQPQQPVSSVINDKKSDAGVSVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAAYEAWQQEN
HPDTQQQMQRREEVNINVHRERGEDVEPGDDF

  Protein domains


Predicted by InterproScan.

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(173-560)

F sex factor protein N terminal (TraD_N)

(32-128)

  Protein structure



No available structure.



ID   1374 GenBank   WP_086217790
Name   traC_C9Z70_RS25415_FWSEC0120|unnamed2 insolico UniProt ID   _
Length   876 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 876 a.a.        Molecular weight: 99302.95 Da        Isoelectric Point: 5.8486

>WP_086217790.1 type IV secretion system protein TraC [Escherichia coli]
MSNNPLEAVTQAVNSLVTALKLPDESAKANEILGEMSFPQFSRLLPYRDYNQESGLFMNDTTLGFMLEAI
PINGANESIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAA
ATQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASITTQTVDAQAFIDIV
GEMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAF
LWNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWG
ELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGK
GLFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSG
AGKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLS
VMASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAESPTIRSRLDEMIVLLDQY
TANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGW
RLLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKY
NQLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEG
LSIHEAVWQLAWKRSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

TraC protein (TraC_F_IV)

(39-277)

TraG P-loop domain (P-loop_TraG)

(468-772)

Family of unknown function (DUF5934) (DUF5934)

(290-447)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 16164..46600

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C9Z70_RS25275 (C9Z70_25315) 15530..15757 + 228 WP_000450532 toxin-antitoxin system antitoxin VapB -
C9Z70_RS25280 (C9Z70_25320) 15757..16155 + 399 WP_001377646 type II toxin-antitoxin system VapC family toxin -
C9Z70_RS25285 (C9Z70_25325) 16164..18362 - 2199 WP_086217781 type IV conjugative transfer system coupling protein TraD virb4
C9Z70_RS25295 (C9Z70_25335) 18607..19086 - 480 WP_001473214 hypothetical protein -
C9Z70_RS25300 (C9Z70_25340) 19290..20021 - 732 WP_024187483 conjugal transfer complement resistance protein TraT -
C9Z70_RS25305 (C9Z70_25345) 20035..20544 - 510 WP_086217783 conjugal transfer entry exclusion protein TraS -
C9Z70_RS25310 (C9Z70_25350) 20541..23366 - 2826 WP_086217784 conjugal transfer mating-pair stabilization protein TraG traG
C9Z70_RS25315 (C9Z70_25355) 23363..24736 - 1374 WP_128863782 conjugal transfer pilus assembly protein TraH traH
C9Z70_RS25320 (C9Z70_25360) 24723..25103 - 381 WP_086217786 F-type conjugal transfer protein TrbF -
C9Z70_RS25325 (C9Z70_25365) 25100..25444 - 345 WP_128863783 P-type conjugative transfer protein TrbJ -
C9Z70_RS25330 (C9Z70_25370) 25374..25919 - 546 WP_053528433 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
C9Z70_RS25335 (C9Z70_25375) 25906..26190 - 285 WP_053528432 type-F conjugative transfer system pilin chaperone TraQ -
C9Z70_RS27110 (C9Z70_25380) 26272..26607 + 336 WP_000736414 hypothetical protein -
C9Z70_RS25345 (C9Z70_25385) 26588..26929 - 342 WP_053528430 conjugal transfer protein TrbA -
C9Z70_RS25350 (C9Z70_25390) 26943..27686 - 744 WP_053528429 type-F conjugative transfer system pilin assembly protein TraF traF
C9Z70_RS25355 (C9Z70_25395) 27679..27936 - 258 WP_053528428 conjugal transfer protein TrbE -
C9Z70_RS25360 (C9Z70_25400) 27963..29813 - 1851 WP_086217788 type-F conjugative transfer system mating-pair stabilization protein TraN traN
C9Z70_RS25365 (C9Z70_25405) 29810..30232 - 423 WP_086217789 HNH endonuclease signature motif containing protein -
C9Z70_RS25370 (C9Z70_25410) 30258..30629 - 372 WP_001578145 hypothetical protein -
C9Z70_RS25375 (C9Z70_25415) 30626..31264 - 639 WP_053528426 type-F conjugative transfer system pilin assembly protein TrbC trbC
C9Z70_RS25380 (C9Z70_25420) 31457..31696 + 240 WP_021572675 hypothetical protein -
C9Z70_RS25385 (C9Z70_25425) 31693..31872 - 180 WP_001750891 hypothetical protein -
C9Z70_RS26365 31964..32053 - 90 Protein_38 type-F conjugative transfer system pilin assembly protein TrbC -
C9Z70_RS25390 (C9Z70_25430) 32080..32598 - 519 WP_000009087 hypothetical protein -
C9Z70_RS25395 (C9Z70_25435) 32661..32969 - 309 WP_000412445 hypothetical protein -
C9Z70_RS25400 (C9Z70_25440) 32996..33988 - 993 WP_000830838 conjugal transfer pilus assembly protein TraU traU
C9Z70_RS25405 (C9Z70_25445) 33985..34617 - 633 WP_053528548 type-F conjugative transfer system protein TraW traW
C9Z70_RS25410 (C9Z70_25450) 34614..35000 - 387 WP_000099690 type-F conjugative transfer system protein TrbI -
C9Z70_RS25415 (C9Z70_25455) 34997..37627 - 2631 WP_086217790 type IV secretion system protein TraC virb4
C9Z70_RS25420 (C9Z70_25460) 37758..38105 - 348 WP_001462164 hypothetical protein -
C9Z70_RS25425 (C9Z70_25465) 38133..38351 - 219 WP_001377841 hypothetical protein -
C9Z70_RS25430 (C9Z70_25470) 38430..38906 - 477 WP_069067324 hypothetical protein -
C9Z70_RS25435 (C9Z70_25475) 38899..39120 - 222 WP_001278689 conjugal transfer protein TraR -
C9Z70_RS25440 (C9Z70_25480) 39255..39770 - 516 WP_086217791 type IV conjugative transfer system lipoprotein TraV traV
C9Z70_RS25445 (C9Z70_25485) 39767..40087 - 321 WP_248784590 conjugal transfer protein TrbD -
C9Z70_RS25450 (C9Z70_25490) 40074..40664 - 591 WP_086217793 conjugal transfer pilus-stabilizing protein TraP -
C9Z70_RS25455 (C9Z70_25495) 40654..42081 - 1428 WP_000146635 F-type conjugal transfer pilus assembly protein TraB traB
C9Z70_RS25460 (C9Z70_25500) 42081..42809 - 729 WP_128573304 type-F conjugative transfer system secretin TraK traK
C9Z70_RS25465 (C9Z70_25505) 42796..43362 - 567 WP_000399792 type IV conjugative transfer system protein TraE traE
C9Z70_RS25470 (C9Z70_25510) 43384..43695 - 312 WP_000012106 type IV conjugative transfer system protein TraL traL
C9Z70_RS25475 (C9Z70_25515) 43710..44069 - 360 WP_086217794 type IV conjugative transfer system pilin TraA -
C9Z70_RS25480 (C9Z70_25520) 44103..44330 - 228 WP_001254388 conjugal transfer relaxosome protein TraY -
C9Z70_RS25485 (C9Z70_25525) 44418..45110 - 693 WP_000332478 PAS domain-containing protein -
C9Z70_RS25490 (C9Z70_25530) 45304..45687 - 384 WP_086217795 conjugal transfer relaxosome DNA-binding protein TraM -
C9Z70_RS25495 (C9Z70_25535) 45998..46600 + 603 WP_086217796 transglycosylase SLT domain-containing protein virB1
C9Z70_RS25500 (C9Z70_25540) 46896..47717 - 822 WP_136780375 DUF932 domain-containing protein -
C9Z70_RS26870 (C9Z70_25545) 47835..48122 - 288 WP_086217798 hypothetical protein -
C9Z70_RS26875 48124..48444 + 321 Protein_63 hypothetical protein -
C9Z70_RS25520 (C9Z70_25560) 48745..48870 - 126 WP_096937776 type I toxin-antitoxin system Hok family toxin -
C9Z70_RS26880 48812..48961 - 150 Protein_65 plasmid maintenance protein Mok -
C9Z70_RS25525 (C9Z70_25565) 49134..49896 - 763 Protein_66 plasmid SOS inhibition protein A -
C9Z70_RS25530 (C9Z70_25570) 49893..50327 - 435 WP_086217800 conjugation system SOS inhibitor PsiB -

Host bacterium

ID   2811 GenBank   NZ_RRGL01000079
Plasmid name   FWSEC0120|unnamed2 Incompatibility group   -
Plasmid size   53721 bp Coordinate of oriT [Strand]   45905..46028 [-]
Host baterium   Escherichia coli strain FWSEC0120

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -