Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   102356
Name   oriT_FWSEC0138|unnamed3 in_silico
Organism   Escherichia coli strain FWSEC0138
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_RRHD01000154 (3618..3670 [+], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_FWSEC0138|unnamed3
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   1367 GenBank   WP_000338972
Name   t4cp2_C9Z88_RS27070_FWSEC0138|unnamed3 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73329.86 Da        Isoelectric Point: 9.1391

>WP_000338972.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDISLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 22150..45155

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C9Z88_RS26930 (C9Z88_26965) 17642..18094 + 453 WP_000101552 CaiF/GrlA family transcriptional regulator -
C9Z88_RS26935 (C9Z88_26970) 18087..18281 + 195 WP_001127358 DUF1187 family protein -
C9Z88_RS26940 (C9Z88_26975) 18327..19280 + 954 WP_072097371 SPFH domain-containing protein -
C9Z88_RS26945 (C9Z88_26980) 19342..19785 + 444 WP_000498521 NfeD family protein -
C9Z88_RS27445 19789..19959 + 171 WP_000550721 hypothetical protein -
C9Z88_RS26950 (C9Z88_26985) 19970..20632 + 663 WP_001243159 hypothetical protein -
C9Z88_RS26960 (C9Z88_26995) 20783..21376 + 594 WP_001243171 hypothetical protein -
C9Z88_RS26970 (C9Z88_27005) 21590..21892 + 303 WP_000189499 hypothetical protein -
C9Z88_RS26975 (C9Z88_27010) 21889..22146 + 258 WP_000739144 hypothetical protein -
C9Z88_RS26980 (C9Z88_27015) 22150..23145 + 996 WP_000276068 type IV secretion system protein virB6
C9Z88_RS26985 (C9Z88_27020) 23151..23792 + 642 WP_001415805 type IV secretion system protein -
C9Z88_RS26990 (C9Z88_27025) 23795..24049 + 255 WP_000609210 EexN family lipoprotein -
C9Z88_RS26995 (C9Z88_27030) 24102..24911 - 810 WP_001005154 DUF5710 domain-containing protein -
C9Z88_RS27000 (C9Z88_27035) 24959..25594 + 636 WP_000835769 hypothetical protein -
C9Z88_RS27005 (C9Z88_27040) 25766..26053 + 288 WP_001326593 TrbM/KikA/MpfK family conjugal transfer protein -
C9Z88_RS27010 (C9Z88_27045) 26056..27291 + 1236 WP_000733393 toxin co-regulated pilus biosynthesis Q family protein -
C9Z88_RS27015 (C9Z88_27050) 27297..27734 + 438 WP_000539665 type IV pilus biogenesis protein PilM -
C9Z88_RS27020 (C9Z88_27055) 27853..28251 + 399 WP_001153669 hypothetical protein -
C9Z88_RS27025 (C9Z88_27060) 28272..28856 + 585 WP_001177114 lytic transglycosylase domain-containing protein virB1
C9Z88_RS27565 28856..29146 + 291 WP_000865478 TrbC/VirB2 family protein virB2
C9Z88_RS27035 (C9Z88_27070) 29217..29537 + 321 WP_000362083 VirB3 family type IV secretion system protein virB3
C9Z88_RS27040 (C9Z88_27075) 29543..31900 + 2358 WP_000548951 VirB4 family type IV secretion system protein virb4
C9Z88_RS27050 (C9Z88_27085) 32066..32800 + 735 WP_000432283 type IV secretion system protein virB8
C9Z88_RS27055 (C9Z88_27090) 32866..33567 + 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
C9Z88_RS27060 (C9Z88_27095) 33557..34696 + 1140 WP_000790639 TrbI/VirB10 family protein virB10
C9Z88_RS27065 (C9Z88_27100) 34779..35834 + 1056 WP_001059977 P-type DNA transfer ATPase VirB11 virB11
C9Z88_RS27070 (C9Z88_27105) 35850..37808 + 1959 WP_000338972 type IV secretory system conjugative DNA transfer family protein -
C9Z88_RS27075 (C9Z88_27110) 37859..39502 + 1644 WP_001035589 PilN family type IVB pilus formation outer membrane protein -
C9Z88_RS27080 (C9Z88_27115) 39553..40863 + 1311 WP_001454111 type 4b pilus protein PilO2 -
C9Z88_RS27085 (C9Z88_27120) 40847..41341 + 495 WP_000912554 type IV pilus biogenesis protein PilP -
C9Z88_RS27090 (C9Z88_27125) 41366..42904 + 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
C9Z88_RS27095 (C9Z88_27130) 42895..44004 + 1110 WP_000974903 type II secretion system F family protein -
C9Z88_RS27100 (C9Z88_27135) 44049..44606 + 558 WP_000095048 type 4 pilus major pilin -
C9Z88_RS27105 (C9Z88_27140) 44673..45155 + 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
C9Z88_RS27110 (C9Z88_27145) 45159..45794 + 636 WP_000934978 A24 family peptidase -
C9Z88_RS27115 (C9Z88_27150) 45807..46848 + 1042 WP_023155257 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -


Host bacterium


ID   2800 GenBank   NZ_RRHD01000154
Plasmid name   FWSEC0138|unnamed3 Incompatibility group   IncI2
Plasmid size   46848 bp Coordinate of oriT [Strand]   3618..3670 [+]
Host baterium   Escherichia coli strain FWSEC0138

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -