Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   102351
Name   oriT_060517CS3-g|unnamed2 in_silico
Organism   Klebsiella pneumoniae strain 060517CS3-g
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_WJRW01000070 (871..928 [+], 58 nt)
oriT length   58 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 58 nt

>oriT_060517CS3-g|unnamed2
GGGTTTCGGGGCGCAGCCCTGAACCAGTCACGTAGCGCTAGCGGAGTGTATACTGGCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   1782 GenBank   WP_153831091
Name   Relaxase_GH809_RS28005_060517CS3-g|unnamed2 insolico UniProt ID   _
Length   148 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 148 a.a.        Molecular weight: 16772.11 Da        Isoelectric Point: 9.2620

>WP_153831091.1 relaxase/mobilization nuclease domain-containing protein, partial [Klebsiella pneumoniae]
MIVKFHPRGRGGGGGPVDYLLGKDRQRDGASVLQGKPDEVRELIDASPYAKKYTSGVLSFAEQDLPPGQR
EKLMASFERVLMPGLDKDQYSVLWVEHRDKGRLELNFLIPNTELLTGKRLQPYYDRADRPRIDAWQTIVN
GRLGLHDP

  Protein domains


Predicted by InterproScan.

(56-129)


  Protein structure



No available structure.




Auxiliary protein


ID   702 GenBank   WP_004193914
Name   WP_004193914_060517CS3-g|unnamed2 insolico UniProt ID   A0A8T3UXZ2
Length   107 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 107 a.a.        Molecular weight: 11783.55 Da        Isoelectric Point: 7.8963

>WP_004193914.1 MULTISPECIES: MobC family plasmid mobilization relaxosome protein [Bacteria]
MLTMWVTEDEHRRLLERCEGKQLAAWMRQTCLDEKPARAGKLPSISPALLRQLAGMGNNLNQIARQVNAG
GGSGHDRVQIVAALMAIDAGLERLRHAVLEKGADDDR

  Protein domains


Predicted by InterproScan.

(50-94)


  Protein structure



No available structure.



ID   703 GenBank   WP_025367738
Name   WP_025367738_060517CS3-g|unnamed2 insolico UniProt ID   A0A626CA34
Length   161 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 161 a.a.        Molecular weight: 18002.58 Da        Isoelectric Point: 9.7366

>WP_025367738.1 MULTISPECIES: MbeB family mobilization protein [Bacteria]
MNSLLTLAKDLEQKSKAQQQTTGEMLKAAFSEHEKSVRAELSESEKRISAAILDHDRKLSSAMSQRTKGM
LRMVSQTWLTIVLVSALLIASSAGILWWQGQQILENYTTIREQKSTQAMLSERNSGVQLSTCGEQRRRCV
RVNPEAGQFGEDSSWMILAGK

  Protein domains


Predicted by InterproScan.

(1-52)


  Protein structure


Source ID Structure
AlphaFold DB A0A626CA34


Host bacterium


ID   2795 GenBank   NZ_WJRW01000070
Plasmid name   060517CS3-g|unnamed2 Incompatibility group   Col440II
Plasmid size   3300 bp Coordinate of oriT [Strand]   871..928 [+]
Host baterium   Klebsiella pneumoniae strain 060517CS3-g

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -