Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   102324
Name   oriT_FWSEC0536|unnamed6 in_silico
Organism   Escherichia coli strain FWSEC0536
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_RRSC01000258 (18099..18222 [-], 124 nt)
oriT length   124 nt
IRs (inverted repeats)      92..99, 113..120  (ATAATGTA..TACATTAT)
 90..95, 107..112  (AAATAA..TTATTT)
 39..46, 49..56  (GCAAAAAC..GTTTTTGC)
 3..10, 15..22  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 124 nt

>oriT_FWSEC0536|unnamed6
GGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTGCTATTTGAATCATTAACTTATGTTTTAAATAATGTATTTTAATTTATTTTACATTATAAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   1354 GenBank   WP_001064239
Name   traC_C9303_RS28265_FWSEC0536|unnamed6 insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99485.47 Da        Isoelectric Point: 6.6265

>WP_001064239.1 MULTISPECIES: type IV secretion system protein TraC [Enterobacteriaceae]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAAA
TQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASFHGAKITTQTVDAQAFIEIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNMADNYSNLLNPEMSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFKGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKKKQARIDDVVDFLKNARDNDQYVESPTIRSRLDEMIVLLDQYT
ANGTYGRYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRTLKKLNVIDEGWR
LLDFKNRKVGEFIQKGYRTCRRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLFPDQFQPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRREGM
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

(467-771)

(290-446)

(38-276)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 1..18794

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C9303_RS28195 (C9303_28245) 1..319 - 319 WP_197733270 conjugal transfer protein TraH traH
C9303_RS28200 (C9303_28250) 306..698 - 393 WP_000660703 F-type conjugal transfer protein TrbF -
C9303_RS28205 (C9303_28255) 679..1020 - 342 WP_001448115 P-type conjugative transfer protein TrbJ -
C9303_RS28210 (C9303_28260) 950..1495 - 546 WP_000059824 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
C9303_RS28215 (C9303_28265) 1482..1766 - 285 WP_001448202 type-F conjugative transfer system pilin chaperone TraQ -
C9303_RS28220 (C9303_28270) 1893..2231 - 339 WP_001287905 conjugal transfer protein TrbA -
C9303_RS28225 (C9303_28275) 2247..2990 - 744 WP_001030371 type-F conjugative transfer system pilin assembly protein TraF traF
C9303_RS28230 (C9303_28280) 2983..3240 - 258 WP_000864320 conjugal transfer protein TrbE -
C9303_RS28235 (C9303_28285) 3267..5075 - 1809 WP_000821863 type-F conjugative transfer system mating-pair stabilization protein TraN traN
C9303_RS28240 (C9303_28290) 5072..5710 - 639 WP_001080257 type-F conjugative transfer system pilin assembly protein TrbC trbC
C9303_RS28245 (C9303_28295) 5719..6024 - 306 WP_000224411 hypothetical protein -
C9303_RS28250 (C9303_28300) 6054..7046 - 993 WP_000830838 conjugal transfer pilus assembly protein TraU traU
C9303_RS28255 (C9303_28305) 7043..7675 - 633 WP_001203720 type-F conjugative transfer system protein TraW traW
C9303_RS28260 (C9303_28310) 7672..8058 - 387 WP_000214082 type-F conjugative transfer system protein TrbI -
C9303_RS28265 (C9303_28315) 8055..10682 - 2628 WP_001064239 type IV secretion system protein TraC virb4
C9303_RS28270 (C9303_28320) 10842..11063 - 222 WP_001278978 conjugal transfer protein TraR -
C9303_RS28275 (C9303_28325) 11198..11713 - 516 WP_000809893 type IV conjugative transfer system lipoprotein TraV traV
C9303_RS28280 (C9303_28330) 11710..11961 - 252 WP_001038341 conjugal transfer protein TrbG -
C9303_RS28285 (C9303_28335) 11954..12274 - 321 WP_001057302 conjugal transfer protein TrbD virb4
C9303_RS28290 (C9303_28340) 12261..12845 - 585 WP_000002795 conjugal transfer pilus-stabilizing protein TraP -
C9303_RS28295 (C9303_28345) 12835..14262 - 1428 WP_000146638 F-type conjugal transfer pilus assembly protein TraB traB
C9303_RS28300 (C9303_28350) 14262..14990 - 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
C9303_RS28305 (C9303_28355) 14977..15543 - 567 WP_000399804 type IV conjugative transfer system protein TraE traE
C9303_RS28310 (C9303_28360) 15565..15876 - 312 WP_000012106 type IV conjugative transfer system protein TraL traL
C9303_RS28315 (C9303_28365) 15881..16243 - 363 WP_001098998 type IV conjugative transfer system pilin TraA -
C9303_RS28320 (C9303_28370) 16277..16504 - 228 WP_001254388 conjugal transfer relaxosome protein TraY -
C9303_RS28325 (C9303_28375) 16598..17284 - 687 WP_000332487 PAS domain-containing protein -
C9303_RS28330 (C9303_28380) 17478..17861 - 384 WP_001151564 conjugal transfer relaxosome DNA-binding protein TraM -
C9303_RS28335 (C9303_28385) 18147..18794 + 648 WP_000614282 transglycosylase SLT domain-containing protein virB1
C9303_RS28340 (C9303_28390) 19091..19912 - 822 WP_001234469 DUF932 domain-containing protein -
C9303_RS28345 (C9303_28395) 20033..20320 - 288 WP_000107537 hypothetical protein -
C9303_RS31975 20618..20791 + 174 Protein_31 hypothetical protein -


Host bacterium


ID   2768 GenBank   NZ_RRSC01000258
Plasmid name   FWSEC0536|unnamed6 Incompatibility group   -
Plasmid size   20862 bp Coordinate of oriT [Strand]   18099..18222 [-]
Host baterium   Escherichia coli strain FWSEC0536

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -