Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   102321
Name   oriT_KPC89|unnamed P30 in_silico
Organism   Klebsiella pneumoniae strain KPC89
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_QXGQ01000062 (37871..37975 [-], 105 nt)
oriT length   105 nt
IRs (inverted repeats)      32..37, 40..45  (GCCGGC..GCCGGC)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 105 nt

>oriT_KPC89|unnamed P30
AGTACGGGACAAGATGTGTTTTTGGTACACCGCCGGCACGCCGGCAGTGACGCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTAT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   1769 GenBank   WP_004206924
Name   Relaxase_DWC17_RS03270_KPC89|unnamed P30 insolico UniProt ID   A0A2V4FJ40
Length   659 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75087.84 Da        Isoelectric Point: 10.0285

>WP_004206924.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFAGIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQLRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

(86-334)


  Protein structure


Source ID Structure
AlphaFold DB A0A2V4FJ40


T4CP


ID   1353 GenBank   WP_004206885
Name   t4cp2_DWC17_RS03155_KPC89|unnamed P30 insolico UniProt ID   _
Length   695 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 695 a.a.        Molecular weight: 79538.91 Da        Isoelectric Point: 4.8317

>WP_004206885.1 MULTISPECIES: conjugal transfer protein TrbC [Enterobacterales]
MQQESVDSKKVLRPDGSFMEWFLTPNVQFGLLAILTVLGLFLPFTMLLSILILPPLMVAFTDRKFRPPLR
MPKDCEMFDDTLTTETQAEYRLGPIRIPHKVRERKKAKGILYVGYERGRLFGRELWLNMTDLLRHMVFFG
TTGSGKTETFYGFIVNFLLWCRGYCLSDGKADNKLAFATWSLARRFGREDDYYVLNLLTGSIDRFVNLVK
QESIPAQSNSVNLFSVAPPTFIIQLMESMLPQVGGDSAQWQDTAKAMMSALINALCYKRARGELLLSQRT
IQKNMSLPAMAALYVEAKKNGWHSEGYAALESYLENTPGFLLANAEYPETWEARAFEQHNYMSRQFLKTL
SLFNETYGHVFPEDSGDIRMDDIFHNDRILIVMIPSLELSRGEAATLGRLYVTLQRMTISKDLGYQLEGK
KEEVLLTHALNNQAPYGLIYDELGQYFTSGMDTLSAQMRSLEKMGVFSSQDHPSLARGANGEVDSLIANT
RVKYFESIEDRKTFEILRETVGQDYYSELSGQEAEHGTFSKTVREGDLYQIREKDRVNIRELRKQTEGQG
VISFQDALVRSAAFYIPDNEKFSSELPMRINRFIEVLPPSPATLYSIYPERKDDELAETNPDAMRFPPIK
LFGYDKAANSLLEKIEVFYELQCGAISPEEMSVCLFELFAEWLDGTETDDVLYHQEDDLFPMIEM

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 7869..35073

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DWC17_RS03115 (DWC17_03125) 3055..3684 + 630 WP_009654921 dihydroxyacetone kinase subunit DhaL -
DWC17_RS03120 (DWC17_03130) 3902..5095 + 1194 WP_032449369 enoyl-ACP reductase FabV -
DWC17_RS03125 (DWC17_03135) 5570..5902 - 333 WP_004187427 type II toxin-antitoxin system toxin endoribonuclease PemK-mt -
DWC17_RS29280 5904..6161 - 258 WP_004187429 type II toxin-antitoxin system antitoxin PemI -
DWC17_RS03130 (DWC17_03140) 6253..6906 - 654 WP_004206890 type II CAAX endopeptidase family protein -
DWC17_RS03135 (DWC17_03145) 6986..7369 + 384 WP_004206889 DUF1496 domain-containing protein -
DWC17_RS03140 (DWC17_03150) 7474..7869 + 396 WP_004187436 lytic transglycosylase domain-containing protein -
DWC17_RS03145 (DWC17_03155) 7869..9176 + 1308 WP_015059988 hypothetical protein trbA
DWC17_RS03150 (DWC17_03160) 9187..10137 + 951 WP_004206886 DsbC family protein trbB
DWC17_RS03155 (DWC17_03165) 10150..12237 + 2088 WP_004206885 conjugal transfer protein TrbC -
DWC17_RS30465 12288..12383 - 96 WP_004206884 DinQ-like type I toxin DqlB -
DWC17_RS03160 (DWC17_03170) 13610..14665 - 1056 WP_021526650 plasmid replication initiator RepA -
DWC17_RS03165 (DWC17_03175) 14962..15192 - 231 WP_004187496 IncL/M type plasmid replication protein RepC -
DWC17_RS03170 (DWC17_03180) 15266..15919 - 654 WP_004206935 hypothetical protein -
DWC17_RS03175 (DWC17_03185) 15922..18102 - 2181 WP_004187492 DotA/TraY family protein traY
DWC17_RS03180 (DWC17_03190) 18095..18745 - 651 WP_004187488 hypothetical protein -
DWC17_RS03185 (DWC17_03195) 18742..19950 - 1209 WP_004187486 conjugal transfer protein TraW traW
DWC17_RS03190 (DWC17_03200) 19947..22997 - 3051 WP_011154474 conjugative transfer protein traU
DWC17_RS03195 (DWC17_03205) 22994..23488 - 495 WP_004187480 hypothetical protein -
DWC17_RS03200 (DWC17_03210) 23534..23923 - 390 WP_011154472 DUF6750 family protein traR
DWC17_RS03205 (DWC17_03215) 23940..24470 - 531 WP_004187478 conjugal transfer protein TraQ traQ
DWC17_RS03210 (DWC17_03220) 24494..25198 - 705 WP_004206933 conjugal transfer protein TraP traP
DWC17_RS03215 (DWC17_03225) 25210..26559 - 1350 WP_004206932 conjugal transfer protein TraO traO
DWC17_RS03220 (DWC17_03230) 26571..27722 - 1152 WP_015062843 DotH/IcmK family type IV secretion protein traN
DWC17_RS03225 (DWC17_03235) 27731..28444 - 714 WP_223294958 DotI/IcmL family type IV secretion protein traM
DWC17_RS03230 (DWC17_03240) 28512..28922 + 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
DWC17_RS03235 (DWC17_03245) 28951..29106 + 156 WP_172693602 Hha/YmoA family nucleoid-associated regulatory protein -
DWC17_RS03240 (DWC17_03250) 29107..29619 - 513 WP_011091071 hypothetical protein traL
DWC17_RS30195 29585..32845 - 3261 WP_219725162 LPD7 domain-containing protein -
DWC17_RS03250 (DWC17_03260) 32870..33130 - 261 WP_004187310 IcmT/TraK family protein traK
DWC17_RS03255 (DWC17_03265) 33120..34283 - 1164 WP_004206926 plasmid transfer ATPase TraJ virB11
DWC17_RS03260 (DWC17_03270) 34294..35073 - 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
DWC17_RS03265 (DWC17_03275) 35070..35570 - 501 WP_004206925 DotD/TraH family lipoprotein -
DWC17_RS03270 (DWC17_03280) 35584..37563 - 1980 WP_004206924 TraI/MobA(P) family conjugative relaxase -
DWC17_RS03275 (DWC17_03285) 37550..37867 - 318 WP_004206923 plasmid mobilization protein MobA -
DWC17_RS03280 (DWC17_03290) 38143..38508 + 366 WP_004206922 hypothetical protein -
DWC17_RS03285 (DWC17_03295) 39009..39545 - 537 WP_004206920 hypothetical protein -
DWC17_RS03290 (DWC17_03300) 39678..39989 - 312 WP_004187333 hypothetical protein -


Host bacterium


ID   2765 GenBank   NZ_QXGQ01000062
Plasmid name   KPC89|unnamed P30 Incompatibility group   IncL/M
Plasmid size   64467 bp Coordinate of oriT [Strand]   37871..37975 [-]
Host baterium   Klebsiella pneumoniae strain KPC89

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -