Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   102308
Name   oriT_TRPF4|unnamed2 in_silico
Organism   Staphylococcus warneri strain TRPF4
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_PJLY01000022 (17344..17463 [-], 120 nt)
oriT length   120 nt
IRs (inverted repeats)      52..59, 61..68  (TTGGGGAT..ATCCCCAA)
 22..29, 34..41  (ATTTTTTT..AAAAAAAT)
 24..29, 35..40  (TTTTTT..AAAAAA)
 23..28, 34..39  (TTTTTT..AAAAAA)
 1..8, 14..21  (AGTGGCTA..TAGCCACT)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 120 nt

>oriT_TRPF4|unnamed2
AGTGGCTATCAATTAGCCACTATTTTTTTCGCCAAAAAAATCTTAAGGGGCTTGGGGATTATCCCCAACAAGCAGGCGCGTCTGCCACGAGAGTGGCTAGCAAAGCCAATGATTGCCAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   1764 GenBank   WP_267472202
Name   Relaxase_CWE31_RS12840_TRPF4|unnamed2 insolico UniProt ID   _
Length   243 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 243 a.a.        Molecular weight: 27976.34 Da        Isoelectric Point: 9.2228

>WP_267472202.1 relaxase/mobilization nuclease domain-containing protein [Staphylococcus warneri]
MATTKLSATKSTSRAINYAEKRAVEKSGLNCDVDYAKSSFKASRELYGKTDGNQGHVIIQSFKPDEVTPE
QCNQLGLELAEKIAPNHQVAMYTHNNTDHIHNHIVINAINLETGKKFNNNKQALRDLRDLNDEVCRAHGL
SVPEKDTARLRYTQTEKAIADPNTKSTAQYSWKDEIREVIDQSQATNMDEFKDHLNQQCFSLYRVYFRRY
NLVNSRKGALMRTFSSRAKTDIDLRRFFYLNFN

  Protein domains


Predicted by InterproScan.

(9-203)


  Protein structure



No available structure.




Host bacterium


ID   2752 GenBank   NZ_PJLY01000022
Plasmid name   TRPF4|unnamed2 Incompatibility group   -
Plasmid size   26387 bp Coordinate of oriT [Strand]   17344..17463 [-]
Host baterium   Staphylococcus warneri strain TRPF4

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA21