Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 102304 |
| Name | oriT_pROT12-5.1  |
| Organism | Rhodanobacter sp. T12-5 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_NPKN01000012 (5208..5229 [+], 22 nt) |
| oriT length | 22 nt |
| IRs (inverted repeats) | 1..6, 16..21 (CCCCCC..GGGGGG) |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 22 nt
>oriT_pROT12-5.1
CCCCCCATGCTAACAGGGGGGT
CCCCCCATGCTAACAGGGGGGT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Relaxase
| ID | 1762 | GenBank | WP_242451968 |
| Name | Mob_Pre_CIW53_RS17445_pROT12-5.1 |
UniProt ID | _ |
| Length | 86 a.a. | PDB ID | |
| Note | Predicted by oriTfinder 2.0 | ||
Relaxase protein sequence
Download Length: 86 a.a. Molecular weight: 10348.78 Da Isoelectric Point: 9.8952
>WP_242451968.1 plasmid recombination protein [Rhodanobacter sp. T12-5]
MRYTKDKLCVTITPIQWSESGVFLMANYAVIRMEKYKKDRLNGTQKHNQREFQKSKNENIDRERTHLNYD
LINEKPISYSKAIHEN
MRYTKDKLCVTITPIQWSESGVFLMANYAVIRMEKYKKDRLNGTQKHNQREFQKSKNENIDRERTHLNYD
LINEKPISYSKAIHEN
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
Host bacterium
| ID | 2748 | GenBank | NZ_NPKN01000012 |
| Plasmid name | pROT12-5.1 | Incompatibility group | Col |
| Plasmid size | 6502 bp | Coordinate of oriT [Strand] | 5208..5229 [+] |
| Host baterium | Rhodanobacter sp. T12-5 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |