Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   102274
Name   oriT_pMU407 in_silico
Organism   Klebsiella pneumoniae strain LKP723703-1
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_PELJ01000038 (25304..25408 [-], 105 nt)
oriT length   105 nt
IRs (inverted repeats)      32..37, 40..45  (GCCGGC..GCCGGC)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 105 nt

>oriT_pMU407
AGTACGGGACAAGATGTGTTTTTGGTACACCGCCGGCACGCCGGCAGTGACGCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTAT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   1747 GenBank   WP_099769959
Name   Relaxase_CSQ78_RS24405_pMU407 insolico UniProt ID   _
Length   659 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75117.87 Da        Isoelectric Point: 10.0285

>WP_099769959.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacteriaceae]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMSMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFAGIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQLRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

(86-334)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 3310..22506

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CSQ78_RS24295 (CSQ78_24065) 998..2065 - 1068 WP_060437507 plasmid replication initiator RepA -
CSQ78_RS24300 (CSQ78_24070) 2350..2580 - 231 WP_004187496 IncL/M type plasmid replication protein RepC -
CSQ78_RS24305 (CSQ78_24075) 2654..3307 - 654 WP_004206935 hypothetical protein -
CSQ78_RS24310 (CSQ78_24080) 3310..5490 - 2181 WP_004187492 DotA/TraY family protein traY
CSQ78_RS24315 (CSQ78_24085) 5483..6133 - 651 WP_004187488 hypothetical protein -
CSQ78_RS24320 (CSQ78_24090) 6130..7338 - 1209 WP_004187486 conjugal transfer protein TraW traW
CSQ78_RS24325 (CSQ78_24095) 7335..10385 - 3051 WP_011154474 conjugative transfer protein traU
CSQ78_RS24330 (CSQ78_24100) 10382..10876 - 495 WP_004187480 hypothetical protein -
CSQ78_RS24335 (CSQ78_24105) 10922..11311 - 390 WP_011154472 DUF6750 family protein traR
CSQ78_RS24340 (CSQ78_24110) 11328..11858 - 531 WP_004187478 conjugal transfer protein TraQ traQ
CSQ78_RS24345 (CSQ78_24115) 11882..12586 - 705 WP_099769957 conjugal transfer protein TraP traP
CSQ78_RS24350 (CSQ78_24120) 12598..13947 - 1350 WP_004206932 conjugal transfer protein TraO traO
CSQ78_RS24355 (CSQ78_24125) 13959..15110 - 1152 WP_015062843 DotH/IcmK family type IV secretion protein traN
CSQ78_RS24360 (CSQ78_24130) 15119..15832 - 714 WP_242444826 DotI/IcmL family type IV secretion protein traM
CSQ78_RS24365 (CSQ78_24135) 15900..16310 + 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
CSQ78_RS24370 (CSQ78_24140) 16339..16494 + 156 WP_172693602 Hha/YmoA family nucleoid-associated regulatory protein -
CSQ78_RS24375 (CSQ78_24145) 16495..17007 - 513 WP_011091071 hypothetical protein traL
CSQ78_RS29715 16973..20278 - 3306 WP_219818010 LPD7 domain-containing protein -
CSQ78_RS24385 (CSQ78_24155) 20303..20563 - 261 WP_004187310 IcmT/TraK family protein traK
CSQ78_RS24390 (CSQ78_24160) 20553..21716 - 1164 WP_004206926 plasmid transfer ATPase TraJ virB11
CSQ78_RS24395 (CSQ78_24165) 21727..22506 - 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
CSQ78_RS24400 (CSQ78_24170) 22503..23003 - 501 WP_004206925 DotD/TraH family lipoprotein -
CSQ78_RS24405 (CSQ78_24175) 23017..24996 - 1980 WP_099769959 TraI/MobA(P) family conjugative relaxase -
CSQ78_RS24410 (CSQ78_24180) 24983..25300 - 318 WP_004206923 plasmid mobilization protein MobA -
CSQ78_RS24415 (CSQ78_24185) 25576..25941 + 366 WP_060437505 hypothetical protein -
CSQ78_RS29720 26442..26597 - 156 WP_227520852 hypothetical protein -
CSQ78_RS29725 26637..26978 - 342 WP_242444827 hypothetical protein -
CSQ78_RS24425 (CSQ78_24195) 27111..27422 - 312 WP_004187333 hypothetical protein -


Host bacterium


ID   2718 GenBank   NZ_PELJ01000038
Plasmid name   pMU407 Incompatibility group   IncL/M
Plasmid size   48857 bp Coordinate of oriT [Strand]   25304..25408 [-]
Host baterium   Klebsiella pneumoniae strain LKP723703-1

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -