Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 102261 |
| Name | oriT_pCA-26 |
| Organism | Citrobacter braakii strain CA-26 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_MTJW01000030 (49502..49554 [+], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pCA-26
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 1327 | GenBank | WP_000338974 |
| Name | t4cp2_BWR12_RS20225_pCA-26 |
UniProt ID | _ |
| Length | 652 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73347.89 Da Isoelectric Point: 9.1391
>WP_000338974.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 7960..30641
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BWR12_RS20090 (BWR12_19980) | 3421..3873 | + | 453 | WP_223666486 | CaiF/GrlA family transcriptional regulator | - |
| BWR12_RS20095 (BWR12_19985) | 3866..4081 | + | 216 | WP_001127357 | DUF1187 family protein | - |
| BWR12_RS26335 | 4074..4250 | + | 177 | WP_000753050 | hypothetical protein | - |
| BWR12_RS20100 (BWR12_19990) | 4277..5230 | + | 954 | WP_072097371 | SPFH domain-containing protein | - |
| BWR12_RS20110 (BWR12_20000) | 5616..6059 | + | 444 | WP_000964333 | NfeD family protein | - |
| BWR12_RS26340 | 6063..6233 | + | 171 | WP_000550721 | hypothetical protein | - |
| BWR12_RS20115 (BWR12_20005) | 6244..6897 | + | 654 | WP_053899054 | hypothetical protein | - |
| BWR12_RS20130 (BWR12_20020) | 7400..7702 | + | 303 | WP_001360345 | hypothetical protein | - |
| BWR12_RS20135 (BWR12_20025) | 7699..7956 | + | 258 | WP_000739144 | hypothetical protein | - |
| BWR12_RS20140 (BWR12_20030) | 7960..8946 | + | 987 | WP_053899058 | type IV secretion system protein | virB6 |
| BWR12_RS20145 (BWR12_20035) | 8952..9599 | + | 648 | WP_022645138 | type IV secretion system protein | - |
| BWR12_RS20150 (BWR12_20040) | 9603..9839 | + | 237 | WP_000750964 | EexN family lipoprotein | - |
| BWR12_RS20155 (BWR12_20045) | 9917..10708 | - | 792 | WP_022645137 | DUF5710 domain-containing protein | - |
| BWR12_RS20160 (BWR12_20050) | 10756..11055 | + | 300 | WP_000835763 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| BWR12_RS20165 (BWR12_20055) | 11058..12293 | + | 1236 | WP_053899060 | toxin co-regulated pilus biosynthesis Q family protein | - |
| BWR12_RS20170 (BWR12_20060) | 12299..12736 | + | 438 | WP_053899063 | type IV pilus biogenesis protein PilM | - |
| BWR12_RS20175 (BWR12_20065) | 12855..13253 | + | 399 | WP_053899065 | hypothetical protein | - |
| BWR12_RS20180 (BWR12_20070) | 13274..13858 | + | 585 | WP_001177113 | lytic transglycosylase domain-containing protein | virB1 |
| BWR12_RS26675 (BWR12_20075) | 13858..14148 | + | 291 | WP_000865479 | conjugal transfer protein | - |
| BWR12_RS20190 (BWR12_20080) | 14219..14539 | + | 321 | WP_000362081 | VirB3 family type IV secretion system protein | virB3 |
| BWR12_RS20195 (BWR12_20085) | 14545..16902 | + | 2358 | WP_104652138 | VirB4 family type IV secretion system protein | virb4 |
| BWR12_RS20205 (BWR12_20095) | 17068..17802 | + | 735 | WP_000432282 | type IV secretion system protein | virB8 |
| BWR12_RS20210 (BWR12_20100) | 17868..18569 | + | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| BWR12_RS20215 (BWR12_20105) | 18559..19698 | + | 1140 | WP_000790641 | TrbI/VirB10 family protein | virB10 |
| BWR12_RS20220 (BWR12_20110) | 19741..20796 | + | 1056 | WP_001059977 | P-type DNA transfer ATPase VirB11 | virB11 |
| BWR12_RS20225 (BWR12_20115) | 20812..22770 | + | 1959 | WP_000338974 | type IV secretory system conjugative DNA transfer family protein | - |
| BWR12_RS20230 (BWR12_20120) | 22817..23353 | + | 537 | WP_001220543 | sigma 54-interacting transcriptional regulator | virb4 |
| BWR12_RS20235 (BWR12_20125) | 23346..24989 | + | 1644 | WP_001035592 | PilN family type IVB pilus formation outer membrane protein | - |
| BWR12_RS20240 (BWR12_20130) | 25040..26350 | + | 1311 | WP_001454111 | type 4b pilus protein PilO2 | - |
| BWR12_RS20245 (BWR12_20135) | 26334..26828 | + | 495 | WP_000912553 | type IV pilus biogenesis protein PilP | - |
| BWR12_RS20250 (BWR12_20140) | 26853..28391 | + | 1539 | WP_000466225 | ATPase, T2SS/T4P/T4SS family | virB11 |
| BWR12_RS20255 (BWR12_20145) | 28382..29491 | + | 1110 | WP_000974903 | type II secretion system F family protein | - |
| BWR12_RS20260 (BWR12_20150) | 29536..30093 | + | 558 | WP_000095048 | type 4 pilus major pilin | - |
| BWR12_RS20265 (BWR12_20155) | 30159..30641 | + | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
| BWR12_RS20270 (BWR12_20160) | 30645..31280 | + | 636 | WP_000934977 | A24 family peptidase | - |
| BWR12_RS20275 (BWR12_20165) | 31293..32669 | + | 1377 | WP_000750519 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| BWR12_RS26885 (BWR12_20170) | 32666..32897 | - | 232 | Protein_38 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| BWR12_RS20305 (BWR12_20195) | 34028..35152 | + | 1125 | WP_000486716 | site-specific integrase | - |
Host bacterium
| ID | 2705 | GenBank | NZ_MTJW01000030 |
| Plasmid name | pCA-26 | Incompatibility group | IncI2 |
| Plasmid size | 60994 bp | Coordinate of oriT [Strand] | 49502..49554 [+] |
| Host baterium | Citrobacter braakii strain CA-26 |
Cargo genes
| Drug resistance gene | mcr-1.1 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |