Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   102255
Name   oriT_FWSEC0540|unnamed5 in_silico
Organism   Escherichia coli strain FWSEC0540
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_RRSG01000266 (11428..11551 [-], 124 nt)
oriT length   124 nt
IRs (inverted repeats)      92..99, 113..120  (ATAATGTA..TACATTAT)
 90..95, 107..112  (AAATAA..TTATTT)
 39..46, 49..56  (GCAAAAAC..GTTTTTGC)
 3..10, 15..22  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 124 nt

>oriT_FWSEC0540|unnamed5
GGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTGCTATTTGAATCATTAACTTATGTTTTAAATAATGTATTTTAATTTATTTTACATTATAAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   1320 GenBank   WP_001064239
Name   traC_C9307_RS27575_FWSEC0540|unnamed5 insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99485.47 Da        Isoelectric Point: 6.6265

>WP_001064239.1 MULTISPECIES: type IV secretion system protein TraC [Enterobacteriaceae]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAAA
TQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASFHGAKITTQTVDAQAFIEIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNMADNYSNLLNPEMSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFKGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKKKQARIDDVVDFLKNARDNDQYVESPTIRSRLDEMIVLLDQYT
ANGTYGRYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRTLKKLNVIDEGWR
LLDFKNRKVGEFIQKGYRTCRRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLFPDQFQPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRREGM
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

TraG P-loop domain (P-loop_TraG)

(467-771)

Family of unknown function (DUF5934) (DUF5934)

(290-446)

TraC protein (TraC_F_IV)

(38-276)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 1..12123

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C9307_RS27560 (C9307_27610) 1..375 - 375 WP_197733250 TraU family protein traU
C9307_RS27565 (C9307_27615) 372..1004 - 633 WP_001203720 type-F conjugative transfer system protein TraW traW
C9307_RS27570 (C9307_27620) 1001..1387 - 387 WP_000214082 type-F conjugative transfer system protein TrbI -
C9307_RS27575 (C9307_27625) 1384..4011 - 2628 WP_001064239 type IV secretion system protein TraC virb4
C9307_RS27580 (C9307_27630) 4171..4392 - 222 WP_001278978 conjugal transfer protein TraR -
C9307_RS27585 (C9307_27635) 4527..5042 - 516 WP_000809893 type IV conjugative transfer system lipoprotein TraV traV
C9307_RS27590 (C9307_27640) 5039..5290 - 252 WP_001038341 conjugal transfer protein TrbG -
C9307_RS27595 (C9307_27645) 5283..5603 - 321 WP_001057302 conjugal transfer protein TrbD virb4
C9307_RS27600 (C9307_27650) 5590..6174 - 585 WP_000002795 conjugal transfer pilus-stabilizing protein TraP -
C9307_RS27605 (C9307_27655) 6164..7591 - 1428 WP_000146638 F-type conjugal transfer pilus assembly protein TraB traB
C9307_RS27610 (C9307_27660) 7591..8319 - 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
C9307_RS27615 (C9307_27665) 8306..8872 - 567 WP_000399804 type IV conjugative transfer system protein TraE traE
C9307_RS27620 (C9307_27670) 8894..9205 - 312 WP_000012106 type IV conjugative transfer system protein TraL traL
C9307_RS27625 (C9307_27675) 9210..9572 - 363 WP_001098998 type IV conjugative transfer system pilin TraA -
C9307_RS27630 (C9307_27680) 9606..9833 - 228 WP_001254388 conjugal transfer relaxosome protein TraY -
C9307_RS27635 (C9307_27685) 9927..10613 - 687 WP_000332487 PAS domain-containing protein -
C9307_RS27640 (C9307_27690) 10807..11190 - 384 WP_001151564 conjugal transfer relaxosome DNA-binding protein TraM -
C9307_RS27645 (C9307_27695) 11476..12123 + 648 WP_000614282 transglycosylase SLT domain-containing protein virB1
C9307_RS27650 (C9307_27700) 12420..13241 - 822 WP_001234469 DUF932 domain-containing protein -
C9307_RS27655 (C9307_27705) 13362..13649 - 288 WP_000107537 hypothetical protein -
C9307_RS31170 (C9307_27710) 13674..13748 - 75 Protein_20 single-stranded DNA-binding protein -

Host bacterium

ID   2699 GenBank   NZ_RRSG01000266
Plasmid name   FWSEC0540|unnamed5 Incompatibility group   -
Plasmid size   13748 bp Coordinate of oriT [Strand]   11428..11551 [-]
Host baterium   Escherichia coli strain FWSEC0540

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -