Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   102250
Name   oriT_pB16 P32b in_silico
Organism   Klebsiella pneumoniae strain B16
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_NTCW01000082 (2091..2150 [-], 60 nt)
oriT length   60 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 60 nt

>oriT_pB16 P32b
GGGTTTCGGGGCGCAGCCCTGAACCAGTCACGTAGCGCTAGCGGAGTGTATACTGGCTTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   1731 GenBank   WP_172412685
Name   Relaxase_CLI87_RS30050_pB16 P32b insolico UniProt ID   _
Length   135 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 135 a.a.        Molecular weight: 15312.53 Da        Isoelectric Point: 8.3739

>WP_172412685.1 relaxase/mobilization nuclease domain-containing protein, partial [Klebsiella pneumoniae]
MIVKFHPRGRGGGAGPVDYLLGKDRQREGASVLQGKPEEVRELIDASPYVKKYTSGVLSFAEADLPPGQR
EKLMASFERVLMPGLDKDQYSILWVEHADKGRLELNFLIPNTELLTGKRLQPYYDRADRPRIDAW

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(57-128)


  Protein structure



No available structure.




Auxiliary protein

ID   674 GenBank   WP_071599364
Name   WP_071599364_pB16 P32b insolico UniProt ID   A0A9Q5XKH5
Length   113 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 113 a.a.        Molecular weight: 12571.54 Da        Isoelectric Point: 8.8015

>WP_071599364.1 MULTISPECIES: MobC family plasmid mobilization relaxosome protein [Enterobacterales]
MADKRNKMLTMWVTEDEHRRLLERCDGKQLAAWMRQTCLDEKPTRAGRLPSISPALLRQLAGMGNNLNQI
ARKVNAGGAGHDRVQIVAALMAIDAGLERLRHAVLEKGPDDDC

  Protein domains


Predicted by InterproScan.

Bacterial mobilisation protein (MobC) (MobC)

(57-100)


  Protein structure



No available structure.




Host bacterium

ID   2694 GenBank   NZ_NTCW01000082
Plasmid name   pB16 P32b Incompatibility group   Col440I
Plasmid size   2980 bp Coordinate of oriT [Strand]   2091..2150 [-]
Host baterium   Klebsiella pneumoniae strain B16

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -