Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   102240
Name   oriT_pKP_DC in_silico
Organism   Klebsiella pneumoniae subsp. pneumoniae strain KP_DC
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_NJGM01000030 (31787..31892 [-], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      30..35, 41..46  (CCGCCG..CGGCGG)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 106 nt

>oriT_pKP_DC
AGTACGGGACAAGATGTGTTTTTGGAGTACCGCCGACACGCGGCGGCCGTCCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTATCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   1728 GenBank   WP_004187323
Name   Relaxase_CER21_RS26695_pKP_DC insolico UniProt ID   A0A3U8KUL3
Length   659 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75179.89 Da        Isoelectric Point: 9.9948

>WP_004187323.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(86-334)


  Protein structure


Source ID Structure
AlphaFold DB A0A3U8KUL3


T4CP

ID   1311 GenBank   WP_004206885
Name   t4cp2_CER21_RS26575_pKP_DC insolico UniProt ID   _
Length   695 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 695 a.a.        Molecular weight: 79538.91 Da        Isoelectric Point: 4.8317

>WP_004206885.1 MULTISPECIES: conjugal transfer protein TrbC [Enterobacterales]
MQQESVDSKKVLRPDGSFMEWFLTPNVQFGLLAILTVLGLFLPFTMLLSILILPPLMVAFTDRKFRPPLR
MPKDCEMFDDTLTTETQAEYRLGPIRIPHKVRERKKAKGILYVGYERGRLFGRELWLNMTDLLRHMVFFG
TTGSGKTETFYGFIVNFLLWCRGYCLSDGKADNKLAFATWSLARRFGREDDYYVLNLLTGSIDRFVNLVK
QESIPAQSNSVNLFSVAPPTFIIQLMESMLPQVGGDSAQWQDTAKAMMSALINALCYKRARGELLLSQRT
IQKNMSLPAMAALYVEAKKNGWHSEGYAALESYLENTPGFLLANAEYPETWEARAFEQHNYMSRQFLKTL
SLFNETYGHVFPEDSGDIRMDDIFHNDRILIVMIPSLELSRGEAATLGRLYVTLQRMTISKDLGYQLEGK
KEEVLLTHALNNQAPYGLIYDELGQYFTSGMDTLSAQMRSLEKMGVFSSQDHPSLARGANGEVDSLIANT
RVKYFESIEDRKTFEILRETVGQDYYSELSGQEAEHGTFSKTVREGDLYQIREKDRVNIRELRKQTEGQG
VISFQDALVRSAAFYIPDNEKFSSELPMRINRFIEVLPPSPATLYSIYPERKDDELAETNPDAMRFPPIK
LFGYDKAANSLLEKIEVFYELQCGAISPEEMSVCLFELFAEWLDGTETDDVLYHQEDDLFPMIEM

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 1693..28991

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CER21_RS26545 (CER21_26420) 1..236 + 236 Protein_0 IS4 family transposase -
CER21_RS26550 (CER21_26425) 251..685 - 435 Protein_1 CPBP family intramembrane glutamate endopeptidase -
CER21_RS26555 (CER21_26430) 765..1148 + 384 WP_019725042 DUF1496 domain-containing protein -
CER21_RS26560 (CER21_26435) 1253..1648 + 396 WP_004187436 lytic transglycosylase domain-containing protein -
CER21_RS26565 (CER21_26440) 1693..2955 + 1263 WP_004206887 hypothetical protein trbA
CER21_RS26570 (CER21_26445) 2966..3916 + 951 WP_004206886 DsbC family protein trbB
CER21_RS26575 (CER21_26450) 3929..6016 + 2088 WP_004206885 conjugal transfer protein TrbC -
CER21_RS29165 6067..6162 - 96 WP_004206884 DinQ-like type I toxin DqlB -
CER21_RS26580 (CER21_26455) 7385..8440 - 1056 WP_015060006 plasmid replication initiator RepA -
CER21_RS26585 (CER21_26460) 8736..8978 - 243 WP_023893611 IncL/M type plasmid replication protein RepC -
CER21_RS26590 (CER21_26465) 9047..9700 - 654 WP_015060005 hypothetical protein -
CER21_RS26595 (CER21_26470) 9702..11897 - 2196 WP_015062834 DotA/TraY family protein traY
CER21_RS26600 (CER21_26475) 11890..12486 - 597 WP_015060003 hypothetical protein -
CER21_RS26605 (CER21_26480) 12483..13691 - 1209 WP_011091082 conjugal transfer protein TraW traW
CER21_RS26610 (CER21_26485) 13688..16738 - 3051 WP_004187482 hypothetical protein traU
CER21_RS26615 (CER21_26490) 16735..17229 - 495 WP_004187480 hypothetical protein -
CER21_RS26620 (CER21_26495) 17275..17664 - 390 WP_004187479 DUF6750 family protein traR
CER21_RS26625 (CER21_26500) 17681..18211 - 531 WP_004187478 conjugal transfer protein TraQ traQ
CER21_RS26630 (CER21_26505) 18235..18939 - 705 WP_015060002 conjugal transfer protein TraP traP
CER21_RS26635 (CER21_26510) 18951..20300 - 1350 WP_004187474 conjugal transfer protein TraO traO
CER21_RS26640 (CER21_26515) 20312..21463 - 1152 WP_004187471 DotH/IcmK family type IV secretion protein traN
CER21_RS26650 (CER21_26520) 21472..22185 - 714 WP_004187467 DotI/IcmL family type IV secretion protein traM
CER21_RS26655 (CER21_26525) 22253..22663 + 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
CER21_RS26660 (CER21_26530) 22692..22847 + 156 WP_172693602 Hha/YmoA family nucleoid-associated regulatory protein -
CER21_RS26665 (CER21_26535) 22848..23360 - 513 WP_011091071 hypothetical protein traL
CER21_RS29060 23326..26763 - 3438 WP_241163967 LPD7 domain-containing protein -
CER21_RS26675 (CER21_26545) 26788..27048 - 261 WP_004187310 IcmT/TraK family protein traK
CER21_RS26680 (CER21_26550) 27038..28201 - 1164 WP_004187313 plasmid transfer ATPase TraJ virB11
CER21_RS26685 (CER21_26555) 28212..28991 - 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
CER21_RS26690 (CER21_26560) 28988..29488 - 501 WP_004187320 DotD/TraH family lipoprotein -
CER21_RS26695 (CER21_26565) 29502..31481 - 1980 WP_004187323 TraI/MobA(P) family conjugative relaxase -
CER21_RS29065 31468..32046 - 579 WP_223811519 plasmid mobilization protein MobA -
CER21_RS26705 (CER21_26575) 32061..32426 + 366 WP_011091067 hypothetical protein -
CER21_RS26710 (CER21_26580) 32926..33462 - 537 WP_011091066 hypothetical protein -
CER21_RS26715 (CER21_26585) 33595..33906 - 312 WP_011091065 hypothetical protein -

Host bacterium

ID   2684 GenBank   NZ_NJGM01000030
Plasmid name   pKP_DC Incompatibility group   IncL/M
Plasmid size   62033 bp Coordinate of oriT [Strand]   31787..31892 [-]
Host baterium   Klebsiella pneumoniae subsp. pneumoniae strain KP_DC

Cargo genes

Drug resistance gene   blaOXA-48
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -