Detailed information of oriT

oriT

The information of the oriT region

• oriTDB ID: 102226
• Name: oriT1_16-424|unnamed3
• Organism: Enterococcus faecalis strain 16-424
• Sequence Completeness: -
• NCBI accession of oriT (coordinates [strand]): NZ_PHLG01000005 (1541..1566 [+], 26 nt)
• oriT length: 26 nt
• IRs (inverted repeats): _
• Location of nic site: _
• Conserved sequence flanking the nic site: _
• Note: Predicted by oriTfinder 2.0

oriT sequence

• Length: 26 nt

>oriT1_16-424|unnamed3
AAGTCTAGTGGGTTATACTTTACATG

oriT secondary structure

Predicted by RNAfold.

Relaxase

Mob_Pre_CWC57_RS15245_16-424|unnamed3

• ID: 1718
• GenBank: WP_002401792
• Name: Mob_Pre_CWC57_RS15245_16-424|unnamed3
• UniProt ID: _
• Length: 264 a.a.
• Note: Predicted by oriTfinder 2.0

Relaxase protein sequence

• Length: 264 a.a.
• Molecular weight: 31859.00 Da
• Isoelectric Point: 8.0518

>WP_002401792.1 plasmid recombination protein [Enterococcus faecalis]
MSFAVARMQKVKSGNLVGVGNHNQRNTDNHSNKDIDVERSHLNYDLVNRTENYKRDIEQFINDNKSSSRA
VRKDAVLINEWIITSDNPFFKDKDDKEIDDLSDYYAMTDKAVKKTIFYGRNGKPETKYFGVRDSNRFIRI
YNKKQERKDNADVEVMSEHLWRVEIELKRDMVDYWNDCFNDLHILKPDWTSPEKLNEQAMVYMLIHEEGK
WGELNKRTKYKYKKIIKEISPIDLTEIMKLTLRENEKQLQKQIDFWHREFRFWE

Protein domains

Predicted by InterproScan.

• Plasmid recombination enzyme (Mob_Pre) (1-100)

• Replication initiation factor (Rep_trans) (118-177)

Protein structure

No available structure.

Host bacterium

• ID: 2670
• GenBank: NZ_PHLG01000005
• Plasmid name: 16-424|unnamed3
• Incompatibility group: -
• Plasmid size: 3763 bp
• Coordinate of oriT [Strand]: 1541..1566 [+]; 130..150 [+]
• Host baterium: Enterococcus faecalis strain 16-424

Cargo genes

• Drug resistance gene: cat, str
• Virulence gene: -
• Metal resistance gene: -
• Degradation gene: -
• Symbiosis gene: -
• Anti-CRISPR: -