Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   102215
Name   oriT_ISU 973|unnamed3 in_silico
Organism   Staphylococcus aureus strain ISU 973
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_LKYD01000134 (1942..1982 [+], 41 nt)
oriT length   41 nt
IRs (inverted repeats)      2..8, 13..19  (ACTTTAT..ATAAAGT)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 41 nt

>oriT_ISU 973|unnamed3
CACTTTATGAATATAAAGTATAATGTGTTATACTTTACATG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   1712 GenBank   WP_142378658
Name   mobV_APW04_RS08815_ISU 973|unnamed3 insolico UniProt ID   _
Length   270 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 270 a.a.        Molecular weight: 31914.11 Da        Isoelectric Point: 5.8113

>WP_142378658.1 MobV family relaxase, partial [Staphylococcus aureus]
MSMIVARMQKMKAENLVGIGNHNQRKTKNHSNPDIDTSLSKLNYDLVDRTQNYKTDIENFINENKTTTRA
VRKDAVLVNEWIISSDKDFFDNLTESEIENFFERSKDYFAEKFGEKNIRYATVHLDESTPHMHMGIVPFD
KDNKLSAKRVFNRQALRDVQEELPKYLQDFQFEIERGQKGSERKNLTVPEFKKLKEEEREIKKELEIKKD
ELMAYTKENKIDKEIDITPIKEMEDVEIETDEKSLFGITKTKTVRQWTGNIVLSEKDYLK

  Protein domains


Predicted by InterproScan.

Plasmid recombination enzyme (Mob_Pre)

(1-193)


  Protein structure



No available structure.




Host bacterium

ID   2659 GenBank   NZ_LKYD01000134
Plasmid name   ISU 973|unnamed3 Incompatibility group   -
Plasmid size   2833 bp Coordinate of oriT [Strand]   1942..1982 [+]
Host baterium   Staphylococcus aureus strain ISU 973

Cargo genes

Drug resistance gene   tet(L)
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -