Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 102014 |
| Name | oriT_ISU 912|unnamed3  |
| Organism | Staphylococcus aureus strain ISU 912 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_LKWL01000071 (4690..4730 [+], 41 nt) |
| oriT length | 41 nt |
| IRs (inverted repeats) | 2..8, 13..19 (ACTTTAT..ATAAAGT) |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 41 nt
>oriT_ISU 912|unnamed3
CACTTTATGAATATAAAGTATAATGTGTTATACTTTACATG
CACTTTATGAATATAAAGTATAATGTGTTATACTTTACATG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Relaxase
| ID | 1607 | GenBank | WP_071938212 |
| Name | Mob_Pre_APV67_RS04940_ISU 912|unnamed3 |
UniProt ID | _ |
| Length | 71 a.a. | PDB ID | |
| Note | Predicted by oriTfinder 2.0 | ||
Relaxase protein sequence
Download Length: 71 a.a. Molecular weight: 8196.26 Da Isoelectric Point: 10.0468
>WP_071938212.1 plasmid recombination protein [Staphylococcus aureus]
MSMIVARMQKMKAENLVGIGNHNQRKTKNHSNPDIDTSLSKLNYDLVDRTQNYKTDIENFINENKTTTRA
V
MSMIVARMQKMKAENLVGIGNHNQRKTKNHSNPDIDTSLSKLNYDLVDRTQNYKTDIENFINENKTTTRA
V
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
Host bacterium
| ID | 2458 | GenBank | NZ_LKWL01000071 |
| Plasmid name | ISU 912|unnamed3 | Incompatibility group | - |
| Plasmid size | 7815 bp | Coordinate of oriT [Strand] | 4690..4730 [+] |
| Host baterium | Staphylococcus aureus strain ISU 912 |
Cargo genes
| Drug resistance gene | aadD |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |