Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   101988
Name   oriT_FWSEC0517|unnamed3 in_silico
Organism   Escherichia coli strain FWSEC0517
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_RRRR01000114 (5834..5957 [+], 124 nt)
oriT length   124 nt
IRs (inverted repeats)      92..99, 113..120  (ATAATGTA..TACATTAT)
 90..95, 107..112  (AAATAA..TTATTT)
 39..46, 49..56  (GCAAAAAC..GTTTTTGC)
 3..10, 15..22  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 124 nt

>oriT_FWSEC0517|unnamed3
GGTTGGTGGTTCTCACCACCAAAAGCACCATACCCCACGCAAAAACAAGTTTTTGCTGATTTGATATTTGAATCATTAACTTATGTTTTAAATAATGTATTTTAATTTATTTTACATTATAAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   1252 GenBank   WP_136755385
Name   traC_C9287_RS25125_FWSEC0517|unnamed3 insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99334.99 Da        Isoelectric Point: 5.6251

>WP_136755385.1 type IV secretion system protein TraC [Escherichia coli]
MNNPLEAVTQAVNSLVTALKLPDESAKANDVLGEMSFPQFSRLLPYRDYNQESGLFMNDSTMGFMLEAIP
INGANETIVEALDHMLRTKLPRGIPLCIHLMSSQLVGERIEYGLREFSWSGEQAERFNAITRAYYMKAAE
TLFPLPEGLNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGAYITTQTVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFRQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERIRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAESPTIRSRLDEMIVLLDQYT
ANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLFPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRQEGL
SIHEAVWQLAWKKSGPEMASLESWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

TraG P-loop domain (P-loop_TraG)

(467-770)

Family of unknown function (DUF5934) (DUF5934)

(289-446)

TraC protein (TraC_F_IV)

(38-276)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 8177..29090

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C9287_RS25035 (C9287_25065) 3280..3582 + 303 WP_001272236 hypothetical protein -
C9287_RS25045 (C9287_25075) 3738..4025 + 288 WP_000107543 hypothetical protein -
C9287_RS25050 (C9287_25080) 4143..4964 + 822 WP_136755384 DUF932 domain-containing protein -
C9287_RS25055 (C9287_25085) 5262..5864 - 603 WP_136755387 transglycosylase SLT domain-containing protein -
C9287_RS25060 (C9287_25090) 6194..6577 + 384 WP_001151560 conjugal transfer relaxosome DNA-binding protein TraM -
C9287_RS25065 (C9287_25095) 6770..7459 + 690 WP_000332473 PAS domain-containing protein -
C9287_RS25070 (C9287_25100) 7547..7774 + 228 WP_032142519 conjugal transfer relaxosome protein TraY -
C9287_RS25075 (C9287_25105) 7809..8162 + 354 WP_021521309 type IV conjugative transfer system pilin TraA -
C9287_RS25080 (C9287_25110) 8177..8488 + 312 WP_000012099 type IV conjugative transfer system protein TraL traL
C9287_RS25085 (C9287_25115) 8510..9076 + 567 WP_000399759 type IV conjugative transfer system protein TraE traE
C9287_RS25090 (C9287_25120) 9063..9791 + 729 WP_001365587 type-F conjugative transfer system secretin TraK traK
C9287_RS25095 (C9287_25125) 9791..11220 + 1430 Protein_18 F-type conjugal transfer pilus assembly protein TraB -
C9287_RS25100 (C9287_25130) 11210..11797 + 588 WP_000002898 conjugal transfer pilus-stabilizing protein TraP -
C9287_RS25105 (C9287_25135) 11784..12104 + 321 WP_001057271 DUF2689 domain-containing protein virb4
C9287_RS25110 (C9287_25140) 12097..12345 + 249 WP_001038340 conjugal transfer protein TrbG -
C9287_RS25115 (C9287_25145) 12345..12860 + 516 WP_000809868 type IV conjugative transfer system lipoprotein TraV traV
C9287_RS25120 (C9287_25150) 12995..13216 + 222 WP_001278980 conjugal transfer protein TraR -
C9287_RS25125 (C9287_25155) 13376..16003 + 2628 WP_136755385 type IV secretion system protein TraC virb4
C9287_RS25130 (C9287_25160) 16000..16386 + 387 WP_033817130 type-F conjugative transfer system protein TrbI -
C9287_RS25135 (C9287_25165) 16383..17015 + 633 WP_000877291 type-F conjugative transfer system protein TraW traW
C9287_RS25140 (C9287_25170) 17012..18004 + 993 WP_000817328 conjugal transfer pilus assembly protein TraU traU
C9287_RS25145 (C9287_25175) 18018..18560 + 543 WP_001365589 hypothetical protein -
C9287_RS25155 (C9287_25185) 19288..19734 + 447 WP_001289131 hypothetical protein -
C9287_RS25160 (C9287_25190) 19738..19900 + 163 Protein_30 TraU family protein -
C9287_RS25165 (C9287_25195) 19921..20100 + 180 WP_000970212 hypothetical protein -
C9287_RS25170 (C9287_25200) 20097..20336 - 240 WP_001066128 hypothetical protein -
C9287_RS25175 (C9287_25205) 20529..21167 + 639 WP_001562875 type-F conjugative transfer system pilin assembly protein TrbC trbC
C9287_RS25180 (C9287_25210) 21164..21544 + 381 WP_024213661 hypothetical protein -
C9287_RS25185 (C9287_25215) 21779..23683 + 1905 WP_250205461 type-F conjugative transfer system mating-pair stabilization protein TraN traN
C9287_RS25190 (C9287_25220) 23697..23954 + 258 WP_000864354 conjugal transfer protein TrbE -
C9287_RS25195 (C9287_25225) 23947..24690 + 744 WP_001030385 type-F conjugative transfer system pilin assembly protein TraF traF
C9287_RS25200 (C9287_25230) 24704..25069 + 366 WP_032206674 hypothetical protein -
C9287_RS25205 (C9287_25235) 25201..25545 + 345 WP_032206675 conjugal transfer protein TrbA -
C9287_RS25215 (C9287_25245) 25942..26232 + 291 WP_021521297 type-F conjugative transfer system pilin chaperone TraQ -
C9287_RS25220 (C9287_25250) 26219..26764 + 546 WP_001457363 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
C9287_RS25225 (C9287_25255) 26754..27068 + 315 WP_001366111 P-type conjugative transfer protein TrbJ -
C9287_RS25230 (C9287_25260) 27022..27414 + 393 WP_250205462 F-type conjugal transfer protein TrbF -
C9287_RS25235 (C9287_25265) 27401..28774 + 1374 WP_136755386 conjugal transfer pilus assembly protein TraH traH
C9287_RS25240 (C9287_25270) 28771..29090 + 320 WP_250205463 conjugal transfer protein TraG N-terminal domain-containing protein traG

Host bacterium

ID   2432 GenBank   NZ_RRRR01000114
Plasmid name   FWSEC0517|unnamed3 Incompatibility group   -
Plasmid size   29090 bp Coordinate of oriT [Strand]   5834..5957 [+]
Host baterium   Escherichia coli strain FWSEC0517

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -