Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   101975
Name   oriT_FWSEC0553|unnamed2 in_silico
Organism   Escherichia coli strain FWSEC0553
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_RRSM01000098 (4386..4509 [+], 124 nt)
oriT length   124 nt
IRs (inverted repeats)      101..106, 119..124  (TTTAAT..ATTAAA)
 90..95, 107..112  (AAATAA..TTATTT)
 57..62, 70..75  (TGATTT..AAATCA)
 41..48, 61..68  (AAAAACAA..TTGTTTTT)
 39..46, 49..56  (GCAAAAAC..GTTTTTGC)
 3..10, 15..22  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 124 nt

>oriT_FWSEC0553|unnamed2
GGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTGTTTTTTAAATCATTAGTTTATGTTCTAAATAATGTATTTTAATTTATTTTATATTATTAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   1249 GenBank   WP_001064245
Name   traC_C9313_RS25320_FWSEC0553|unnamed2 insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99159.81 Da        Isoelectric Point: 5.8486

>WP_001064245.1 MULTISPECIES: type IV secretion system protein TraC [Enterobacteriaceae]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAAA
TQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASITTQTVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNVADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAESPTIRSRLDEMIVLLDQYT
ANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

Family of unknown function (DUF5934) (DUF5934)

(289-446)

TraC protein (TraC_F_IV)

(38-276)

TraG P-loop domain (P-loop_TraG)

(467-771)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 3814..17098

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C9313_RS25210 (C9313_25270) 80..226 + 147 Protein_0 conjugation system SOS inhibitor PsiB family protein -
C9313_RS25215 (C9313_25275) 223..985 + 763 Protein_1 plasmid SOS inhibition protein A -
C9313_RS26325 1159..1311 + 153 Protein_2 DUF5431 family protein -
C9313_RS25220 (C9313_25280) 1256..1378 + 123 WP_223200913 Hok/Gef family protein -
C9313_RS25760 1471..1638 + 168 WP_001422689 hypothetical protein -
C9313_RS26330 1854..1991 - 138 Protein_5 hypothetical protein -
C9313_RS25875 (C9313_25290) 2061..2267 + 207 WP_000547959 hypothetical protein -
C9313_RS25235 (C9313_25295) 2292..2579 + 288 WP_000107542 hypothetical protein -
C9313_RS25240 (C9313_25300) 2697..3518 + 822 WP_074148718 DUF932 domain-containing protein -
C9313_RS25245 (C9313_25305) 3814..4416 - 603 WP_077793300 transglycosylase SLT domain-containing protein virB1
C9313_RS25255 (C9313_25315) 4738..5121 + 384 WP_050940374 conjugal transfer relaxosome DNA-binding protein TraM -
C9313_RS25260 (C9313_25320) 5312..5998 + 687 WP_050940377 PAS domain-containing protein -
C9313_RS25265 (C9313_25325) 6092..6319 + 228 WP_050940379 conjugal transfer relaxosome protein TraY -
C9313_RS25270 (C9313_25330) 6353..6712 + 360 WP_000340272 type IV conjugative transfer system pilin TraA -
C9313_RS25275 (C9313_25335) 6727..7038 + 312 WP_000012106 type IV conjugative transfer system protein TraL traL
C9313_RS25280 (C9313_25340) 7060..7626 + 567 WP_050940381 type IV conjugative transfer system protein TraE traE
C9313_RS25285 (C9313_25345) 7670..8341 + 672 WP_001340581 type-F conjugative transfer system secretin TraK traK
C9313_RS25290 (C9313_25350) 8341..9768 + 1428 WP_050940383 F-type conjugal transfer pilus assembly protein TraB traB
C9313_RS25295 (C9313_25355) 9758..10348 + 591 WP_050940386 conjugal transfer pilus-stabilizing protein TraP -
C9313_RS25300 (C9313_25360) 10335..10532 + 198 WP_001324648 conjugal transfer protein TrbD -
C9313_RS25305 (C9313_25365) 10544..10795 + 252 WP_050940388 conjugal transfer protein TrbG -
C9313_RS25310 (C9313_25370) 10792..11307 + 516 WP_000809838 type IV conjugative transfer system lipoprotein TraV traV
C9313_RS25315 (C9313_25375) 11442..11663 + 222 WP_001278689 conjugal transfer protein TraR -
C9313_RS25320 (C9313_25380) 11823..14450 + 2628 WP_001064245 type IV secretion system protein TraC virb4
C9313_RS25325 (C9313_25385) 14447..14833 + 387 WP_050940390 type-F conjugative transfer system protein TrbI -
C9313_RS25330 (C9313_25390) 14830..15462 + 633 WP_001203720 type-F conjugative transfer system protein TraW traW
C9313_RS25335 (C9313_25395) 15459..16451 + 993 WP_000830183 conjugal transfer pilus assembly protein TraU traU
C9313_RS25340 (C9313_25400) 16460..17098 + 639 WP_000777695 type-F conjugative transfer system pilin assembly protein TrbC trbC
C9313_RS25345 (C9313_25405) 17095..17664 + 570 Protein_28 conjugal transfer protein TraN -

Host bacterium

ID   2419 GenBank   NZ_RRSM01000098
Plasmid name   FWSEC0553|unnamed2 Incompatibility group   -
Plasmid size   17741 bp Coordinate of oriT [Strand]   4386..4509 [+]
Host baterium   Escherichia coli strain FWSEC0553

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -