Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   101967
Name   oriT_FWSEC0530|unnamed2 in_silico
Organism   Escherichia coli strain FWSEC0530
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_RRRY01000068 (42346..42399 [-], 54 nt)
oriT length   54 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 54 nt

>oriT_FWSEC0530|unnamed2
CACAAGCATTGTAACATGCCCGGAACGGGCTTGTGTACAAAGCTTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   1248 GenBank   WP_000338974
Name   t4cp2_C9299_RS24150_FWSEC0530|unnamed2 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73347.89 Da        Isoelectric Point: 9.1391

>WP_000338974.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 2328..24777

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C9299_RS25375 (C9299_24150) 1..76 - 76 Protein_0 prepilin -
C9299_RS24105 (C9299_24160) 390..1676 - 1287 WP_015057162 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
C9299_RS24110 (C9299_24165) 1689..2324 - 636 WP_000934979 A24 family peptidase -
C9299_RS24115 (C9299_24170) 2328..2810 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
C9299_RS24120 (C9299_24175) 2876..3433 - 558 WP_000095048 type 4 pilus major pilin -
C9299_RS24125 (C9299_24180) 3478..4587 - 1110 WP_000974903 type II secretion system F family protein -
C9299_RS24130 (C9299_24185) 4578..6131 - 1554 WP_000466228 ATPase, T2SS/T4P/T4SS family virB11
C9299_RS24135 (C9299_24190) 6156..6650 - 495 WP_000912553 type IV pilus biogenesis protein PilP -
C9299_RS24140 (C9299_24195) 6634..7944 - 1311 WP_250205619 type 4b pilus protein PilO2 -
C9299_RS24145 (C9299_24200) 7995..9638 - 1644 WP_136758591 PilN family type IVB pilus formation outer membrane protein -
C9299_RS24150 (C9299_24205) 9689..11647 - 1959 WP_000338974 type IV secretory system conjugative DNA transfer family protein -
C9299_RS24155 (C9299_24210) 11663..12718 - 1056 WP_021575850 P-type DNA transfer ATPase VirB11 virB11
C9299_RS24160 (C9299_24215) 12769..13908 - 1140 WP_000790641 TrbI/VirB10 family protein virB10
C9299_RS24165 (C9299_24220) 13898..14599 - 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
C9299_RS24170 (C9299_24225) 14665..15399 - 735 WP_000432282 type IV secretion system protein virB8
C9299_RS24180 (C9299_24235) 15565..17922 - 2358 WP_000548953 VirB4 family type IV secretion system protein virb4
C9299_RS24185 (C9299_24240) 17928..18248 - 321 WP_136758592 VirB3 family type IV secretion system protein virB3
C9299_RS24795 18319..18609 - 291 WP_000865478 TrbC/VirB2 family protein virB2
C9299_RS24195 (C9299_24250) 18609..19193 - 585 WP_001177118 lytic transglycosylase domain-containing protein virB1
C9299_RS24200 (C9299_24255) 19214..19612 - 399 WP_001153669 hypothetical protein -
C9299_RS24205 (C9299_24260) 19731..20168 - 438 WP_100033418 type IV pilus biogenesis protein PilM -
C9299_RS24210 (C9299_24265) 20174..21409 - 1236 WP_021575847 toxin co-regulated pilus biosynthesis Q family protein -
C9299_RS24215 (C9299_24270) 21412..21699 - 288 WP_001326593 TrbM/KikA/MpfK family conjugal transfer protein -
C9299_RS24220 (C9299_24275) 21871..22506 - 636 WP_000835773 hypothetical protein -
C9299_RS24225 (C9299_24280) 22579..22866 - 288 WP_001032611 EexN family lipoprotein -
C9299_RS24230 (C9299_24285) 22879..23133 - 255 WP_001043555 EexN family lipoprotein -
C9299_RS24235 (C9299_24290) 23135..23776 - 642 WP_001425343 type IV secretion system protein -
C9299_RS24240 (C9299_24295) 23782..24777 - 996 WP_001028543 type IV secretion system protein virB6
C9299_RS24245 (C9299_24300) 24781..25038 - 258 WP_000739144 hypothetical protein -
C9299_RS24250 (C9299_24305) 25035..25337 - 303 WP_001360345 hypothetical protein -
C9299_RS24255 (C9299_24310) 25318..25575 - 258 WP_024241063 hypothetical protein -
C9299_RS24260 (C9299_24315) 25609..26262 - 654 WP_136758593 hypothetical protein -
C9299_RS24715 26273..26443 - 171 WP_000550721 hypothetical protein -
C9299_RS24265 (C9299_24320) 26447..26890 - 444 WP_000498521 NfeD family protein -
C9299_RS24270 (C9299_24325) 26952..27905 - 954 WP_072089442 SPFH domain-containing protein -
C9299_RS24720 27932..28108 - 177 WP_000753050 hypothetical protein -
C9299_RS24275 (C9299_24330) 28101..28316 - 216 WP_001127357 DUF1187 family protein -
C9299_RS24280 (C9299_24335) 28309..28761 - 453 WP_000101552 CaiF/GrlA family transcriptional regulator -


Host bacterium


ID   2411 GenBank   NZ_RRRY01000068
Plasmid name   FWSEC0530|unnamed2 Incompatibility group   IncI2
Plasmid size   54665 bp Coordinate of oriT [Strand]   42346..42399 [-]
Host baterium   Escherichia coli strain FWSEC0530

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -