Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   101961
Name   oriT_FWSEC0530|unnamed1 in_silico
Organism   Escherichia coli strain FWSEC0530
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_RRRY01000067 (25679..26031 [-], 353 nt)
oriT length   353 nt
IRs (inverted repeats)      256..263, 272..279  (ACCGCTAG..CTAGCGGT)
 192..198, 206..212  (TATAAAA..TTTTATA)
 66..71, 74..79  (CTTTAT..ATAAAG)
 40..47, 50..57  (GCAAAAAC..GTTTTTGC)
 4..11, 16..23  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 353 nt

>oriT_FWSEC0530|unnamed1
AGGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTTTCTTTATAAATAAAGTGTTATGAAAAATTAGTTTCTCTTACTCTCTTTATGATATTTAAAAAAGCGGTGTCGGCGCGGCTACAACAACGCGCCGACACCGCTTTGTAGGGGTGGTACTGATTATTTTTATAAAAAACATTATTTTATATTAGGGGGGGCTGCTAGCGGCGCGGTGTGTTTTTTTATAGGATACCGCTAGGGGCGCTGCTAGCGGTGCGTCCCTGTTTGCATTATGAATTTTAGTGTTTCGAAATTAACTTTATTTTATGTTCAAAAAAGGTAATCTCTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   1245 GenBank   WP_136758589
Name   traD_C9299_RS23625_FWSEC0530|unnamed1 insolico UniProt ID   _
Length   646 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 646 a.a.        Molecular weight: 73622.45 Da        Isoelectric Point: 6.2119

>WP_136758589.1 type IV conjugative transfer system coupling protein TraD, partial [Escherichia coli]
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILVGLVLWVKISWQTFVNGCIYWWCTTLEGMR
DLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLASVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTDNPKDVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGVGKSEVIRRLANYAR
QRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGEPFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRSRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHEIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLFL
KYQERPKVAPEFIPREINPEMENRLSAVLAAREAEGRQMASLFEPDVPEVVSGEGVVQAEQPQQPQQPQQ
PQQPQQPQQPQQPQQP

  Protein domains


Predicted by InterproScan.

F sex factor protein N terminal (TraD_N)

(32-128)

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(173-560)

  Protein structure



No available structure.



ID   1246 GenBank   WP_044862953
Name   traC_C9299_RS23715_FWSEC0530|unnamed1 insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99175.81 Da        Isoelectric Point: 5.8486

>WP_044862953.1 type IV secretion system protein TraC [Escherichia coli]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAAA
TQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASITTQTVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNVADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYSKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAESPTIRSRLDEMIVLLDQYT
ANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

Family of unknown function (DUF5934) (DUF5934)

(289-446)

TraC protein (TraC_F_IV)

(38-276)

TraG P-loop domain (P-loop_TraG)

(467-771)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 1..26602

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C9299_RS23625 (C9299_23680) 1..1937 - 1937 WP_136758589 type IV conjugative transfer system coupling protein TraD virb4
C9299_RS23630 (C9299_23685) 2219..2698 - 480 WP_001473214 hypothetical protein -
C9299_RS23635 (C9299_23690) 2902..3633 - 732 WP_024187483 conjugal transfer complement resistance protein TraT -
C9299_RS23640 (C9299_23695) 3665..4162 - 498 WP_038341570 surface exclusion protein -
C9299_RS23645 (C9299_23700) 4187..7000 - 2814 WP_050866957 conjugal transfer mating-pair stabilization protein TraG traG
C9299_RS23650 (C9299_23705) 6997..8370 - 1374 WP_044862960 conjugal transfer pilus assembly protein TraH traH
C9299_RS23655 (C9299_23710) 8357..8749 - 393 WP_044862959 F-type conjugal transfer protein TrbF -
C9299_RS23660 (C9299_23715) 8736..9078 - 343 Protein_7 P-type conjugative transfer protein TrbJ -
C9299_RS23665 (C9299_23720) 9008..9562 - 555 WP_044862958 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
C9299_RS23670 (C9299_23725) 9549..9833 - 285 WP_000624109 type-F conjugative transfer system pilin chaperone TraQ -
C9299_RS23675 (C9299_23730) 9952..10299 - 348 WP_044862957 conjugal transfer protein TrbA -
C9299_RS23680 (C9299_23735) 10315..11058 - 744 WP_001030378 type-F conjugative transfer system pilin assembly protein TraF traF
C9299_RS23685 (C9299_23740) 11051..11308 - 258 WP_044862956 conjugal transfer protein TrbE -
C9299_RS23690 (C9299_23745) 11335..13143 - 1809 WP_044862955 type-F conjugative transfer system mating-pair stabilization protein TraN traN
C9299_RS23695 (C9299_23750) 13140..13778 - 639 WP_044862954 type-F conjugative transfer system pilin assembly protein TrbC trbC
C9299_RS23700 (C9299_23755) 13787..14779 - 993 WP_024226181 conjugal transfer pilus assembly protein TraU traU
C9299_RS23705 (C9299_23760) 14776..15408 - 633 WP_001203720 type-F conjugative transfer system protein TraW traW
C9299_RS23710 (C9299_23765) 15405..15791 - 387 WP_000099690 type-F conjugative transfer system protein TrbI -
C9299_RS23715 (C9299_23770) 15788..18415 - 2628 WP_044862953 type IV secretion system protein TraC virb4
C9299_RS23720 (C9299_23775) 18575..18796 - 222 WP_001278689 conjugal transfer protein TraR -
C9299_RS23725 (C9299_23780) 18931..19446 - 516 WP_044862951 type IV conjugative transfer system lipoprotein TraV traV
C9299_RS23730 (C9299_23785) 19443..19694 - 252 WP_044862950 conjugal transfer protein TrbG -
C9299_RS23735 (C9299_23790) 19706..19903 - 198 WP_001324648 conjugal transfer protein TrbD -
C9299_RS23740 (C9299_23795) 19890..20480 - 591 WP_050866956 conjugal transfer pilus-stabilizing protein TraP -
C9299_RS23745 (C9299_23800) 20470..21897 - 1428 WP_052920911 F-type conjugal transfer pilus assembly protein TraB traB
C9299_RS23750 (C9299_23805) 21897..22625 - 729 WP_044862948 type-F conjugative transfer system secretin TraK traK
C9299_RS23755 (C9299_23810) 22612..23178 - 567 WP_044862947 type IV conjugative transfer system protein TraE traE
C9299_RS23760 (C9299_23815) 23200..23511 - 312 WP_000012126 type IV conjugative transfer system protein TraL traL
C9299_RS23765 (C9299_23820) 23526..23891 - 366 WP_000994782 type IV conjugative transfer system pilin TraA -
C9299_RS23770 (C9299_23825) 23924..24319 - 396 WP_001309237 conjugal transfer relaxosome DNA-bindin protein TraY -
C9299_RS23775 (C9299_23830) 24418..25107 - 690 WP_044862946 conjugal transfer transcriptional regulator TraJ -
C9299_RS23780 (C9299_23835) 25294..25678 - 385 Protein_31 conjugal transfer relaxosome DNA-binding protein TraM -
C9299_RS23785 (C9299_23840) 26000..26602 + 603 WP_000243701 transglycosylase SLT domain-containing protein virB1
C9299_RS23790 (C9299_23845) 26898..27719 - 822 WP_044862944 DUF932 domain-containing protein -
C9299_RS23795 (C9299_23850) 27838..28124 - 287 Protein_34 hypothetical protein -
C9299_RS24790 28442..28720 + 279 Protein_35 hypothetical protein -
C9299_RS23815 (C9299_23870) 29021..29143 - 123 WP_223195199 Hok/Gef family protein -
C9299_RS25175 29088..29240 - 153 Protein_37 DUF5431 family protein -
C9299_RS23820 (C9299_23875) 29391..30177 - 787 Protein_38 plasmid SOS inhibition protein A -
C9299_RS23825 (C9299_23880) 30174..30608 - 435 WP_000845873 conjugation system SOS inhibitor PsiB -

Host bacterium

ID   2405 GenBank   NZ_RRRY01000067
Plasmid name   FWSEC0530|unnamed1 Incompatibility group   IncFIB
Plasmid size   73425 bp Coordinate of oriT [Strand]   25679..26031 [-]
Host baterium   Escherichia coli strain FWSEC0530

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -