Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   101931
Name   oriT_SMo01|unnamed1 in_silico
Organism   Salmonella enterica subsp. enterica serovar Montevideo strain SMo01
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MATD01000001 (5486..5545 [-], 60 nt)
oriT length   60 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 60 nt

>oriT_SMo01|unnamed1
GGGTTTCGGGGCGCAGCCCTGAACCAGTCACGTAGCGCTAGCGGAGTGTATACTGGCTTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   1563 GenBank   WP_171843238
Name   Relaxase_BBC49_RS00045_SMo01|unnamed1 insolico UniProt ID   _
Length   131 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 131 a.a.        Molecular weight: 14913.08 Da        Isoelectric Point: 9.5894

>WP_171843238.1 relaxase/mobilization nuclease domain-containing protein, partial [Salmonella enterica]
MIVKFHPRGRGGGAGPVDYLLGKDRQREGATVLQGKPEEVRELIDASPYAKKYTSGVLSFAEKDLPPGQR
EKLMASFERVLMPGLDKDQYSVLWVEHQDKGRLELNFLIPNTELLTGKRLQPYYDRADRPR

  Protein domains


Predicted by InterproScan.

(55-128)


  Protein structure



No available structure.




Auxiliary protein


ID   633 GenBank   WP_023343076
Name   WP_023343076_SMo01|unnamed1 insolico UniProt ID   A0A625XR88
Length   161 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 161 a.a.        Molecular weight: 18085.72 Da        Isoelectric Point: 10.0592

>WP_023343076.1 MULTISPECIES: MbeB family mobilization protein [Bacteria]
MNSLLTLAKDLEQKSKAQQQSTGEMLKAAFSEHEKSVRAELSESEKRISAAILDHDRKLSSAMSQRTKGM
LRMVSQTWLTIVLVSVLLIASNAAILWWQSQQILDNYVSIREQKSTQAMLSERNSGVQLSTCGEQRRRCV
RVNPEAGRFGEDSSWMILAGK

  Protein domains


Predicted by InterproScan.

(1-52)


  Protein structure


Source ID Structure
AlphaFold DB A0A625XR88

ID   634 GenBank   WP_001445156
Name   WP_001445156_SMo01|unnamed1 insolico UniProt ID   K4I175
Length   107 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 107 a.a.        Molecular weight: 11755.49 Da        Isoelectric Point: 7.8963

>WP_001445156.1 MULTISPECIES: MobC family plasmid mobilization relaxosome protein [Bacteria]
MLTMWVTEDEHRRLLERCDGKQLAAWMRQTCLDEKPARAGKLPSISPALLRQLAGMGNNLNQIARQVNAG
GGSGHDRVQVVAALMAIDAGLERLRHAVLEKGADDDR

  Protein domains


Predicted by InterproScan.

(50-94)


  Protein structure


Source ID Structure
AlphaFold DB K4I175


Host bacterium


ID   2375 GenBank   NZ_MATD01000001
Plasmid name   SMo01|unnamed1 Incompatibility group   ColRNAI
Plasmid size   6364 bp Coordinate of oriT [Strand]   5486..5545 [-]
Host baterium   Salmonella enterica subsp. enterica serovar Montevideo strain SMo01

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -