Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   101855
Name   oriT_pDCCK-1.1 in_silico
Organism   Enterobacter hormaechei strain HA16Eho
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_JAMQJW010000022 (44378..44482 [-], 105 nt)
oriT length   105 nt
IRs (inverted repeats)      32..37, 40..45  (GCCGGC..GCCGGC)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 105 nt

>oriT_pDCCK-1.1
AGTACGGGACAAGATGTGTTTTTGGTACACCGCCGGCACGCCGGCAGTGACGCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTAT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   1533 GenBank   WP_004206924
Name   Relaxase_NDQ76_RS20130_pDCCK-1.1 insolico UniProt ID   A0A2V4FJ40
Length   659 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75087.84 Da        Isoelectric Point: 10.0285

>WP_004206924.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFAGIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQLRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(86-334)


  Protein structure


Source ID Structure
AlphaFold DB A0A2V4FJ40


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 22384..41580

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NDQ76_RS20000 (NDQ76_20000) 17796..17984 - 189 Protein_17 MerC family mercury resistance protein -
NDQ76_RS20005 (NDQ76_20005) 18012..18287 - 276 WP_000732275 mercury resistance system periplasmic binding protein MerP -
NDQ76_RS20010 (NDQ76_20010) 18303..18653 - 351 WP_031623830 mercuric ion transporter MerT -
NDQ76_RS20015 (NDQ76_20015) 18725..19180 + 456 WP_001166628 Hg(II)-responsive transcriptional regulator -
NDQ76_RS20020 (NDQ76_20020) 20072..21127 - 1056 WP_230206039 plasmid replication initiator RepA -
NDQ76_RS20025 (NDQ76_20025) 21424..21654 - 231 WP_004187496 IncL/M type plasmid replication protein RepC -
NDQ76_RS20030 (NDQ76_20030) 21728..22381 - 654 WP_004206935 hypothetical protein -
NDQ76_RS20035 (NDQ76_20035) 22384..24564 - 2181 WP_004187492 DotA/TraY family protein traY
NDQ76_RS20040 (NDQ76_20040) 24557..25207 - 651 WP_004187488 hypothetical protein -
NDQ76_RS20045 (NDQ76_20045) 25204..26412 - 1209 WP_004187486 conjugal transfer protein TraW traW
NDQ76_RS20050 (NDQ76_20050) 26409..29459 - 3051 WP_011154474 conjugative transfer protein traU
NDQ76_RS20055 (NDQ76_20055) 29456..29950 - 495 WP_004187480 hypothetical protein -
NDQ76_RS20060 (NDQ76_20060) 29996..30385 - 390 WP_011154472 DUF6750 family protein traR
NDQ76_RS20065 (NDQ76_20065) 30402..30932 - 531 WP_004187478 conjugal transfer protein TraQ traQ
NDQ76_RS20070 (NDQ76_20070) 30956..31660 - 705 WP_004206933 conjugal transfer protein TraP traP
NDQ76_RS20075 (NDQ76_20075) 31672..33021 - 1350 WP_004206932 conjugal transfer protein TraO traO
NDQ76_RS20080 (NDQ76_20080) 33033..34184 - 1152 WP_015062843 DotH/IcmK family type IV secretion protein traN
NDQ76_RS20085 (NDQ76_20085) 34193..34906 - 714 WP_223294958 DotI/IcmL family type IV secretion protein traM
NDQ76_RS20090 (NDQ76_20090) 34974..35384 + 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
NDQ76_RS20095 (NDQ76_20095) 35413..35568 + 156 WP_172693602 Hha/YmoA family nucleoid-associated regulatory protein -
NDQ76_RS20100 (NDQ76_20100) 35569..36081 - 513 WP_011091071 hypothetical protein traL
NDQ76_RS20105 (NDQ76_20105) 36047..39352 - 3306 WP_242781107 LPD7 domain-containing protein -
NDQ76_RS20110 (NDQ76_20110) 39377..39637 - 261 WP_004187310 IcmT/TraK family protein traK
NDQ76_RS20115 (NDQ76_20115) 39627..40790 - 1164 WP_004206926 plasmid transfer ATPase TraJ virB11
NDQ76_RS20120 (NDQ76_20120) 40801..41580 - 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
NDQ76_RS20125 (NDQ76_20125) 41577..42077 - 501 WP_004206925 DotD/TraH family lipoprotein -
NDQ76_RS20130 (NDQ76_20130) 42091..44070 - 1980 WP_004206924 TraI/MobA(P) family conjugative relaxase -
NDQ76_RS20135 (NDQ76_20135) 44057..44374 - 318 WP_004206923 plasmid mobilization protein MobA -
NDQ76_RS20140 (NDQ76_20140) 44650..45015 + 366 WP_058672219 hypothetical protein -
NDQ76_RS20145 (NDQ76_20145) 45516..46052 - 537 WP_004206920 hypothetical protein -
NDQ76_RS20150 (NDQ76_20150) 46185..46496 - 312 WP_004187333 hypothetical protein -

Host bacterium

ID   2299 GenBank   NZ_JAMQJW010000022
Plasmid name   pDCCK-1.1 Incompatibility group   IncL/M
Plasmid size   67953 bp Coordinate of oriT [Strand]   44378..44482 [-]
Host baterium   Enterobacter hormaechei strain HA16Eho

Cargo genes

Drug resistance gene   blaKPC-2
Virulence gene   -
Metal resistance gene   merP, merT, merR
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -