Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   101813
Name   oriT_pECC30-4 in_silico
Organism   Enterobacter hormaechei strain ECC30
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_JAIEUG010000005 (1178..1237 [+], 60 nt)
oriT length   60 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 60 nt

>oriT_pECC30-4
GGGTTTCGGGGCGCAGCCCTGAACCAGTCACGTAGCGCTAGCGGAGTGTATACTGGCTTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   1514 GenBank   WP_220308913
Name   Relaxase_K2J21_RS24405_pECC30-4 insolico UniProt ID   _
Length   251 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 251 a.a.        Molecular weight: 27655.30 Da        Isoelectric Point: 7.3181

>WP_220308913.1 relaxase/mobilization nuclease domain-containing protein, partial [Enterobacter hormaechei]
MIVKFHPRGRGGGAGPVDYLLGKDRQREGATVLQGKPEEVRELIDASPYVKKYTSGVLSFAEADLPPGQR
EKLMASFERVLMPGLDKDQYSILWVEHADKGRLELNFLIPNTELLTGRRLQPYYDRADRPRIDAWQTVVN
GRLGLLDPNAPENRRALVTPAGLPKTKQDAAEAITRGLLSLASSGELKSRHDVTEALERSGFEVVRTTKS
SISIADPDGGRNIRLKGAIYEQSFNAGEGLRAAIESAAEEY

  Protein domains


Predicted by InterproScan.

(57-238)


  Protein structure



No available structure.




Auxiliary protein


ID   607 GenBank   WP_180264886
Name   WP_180264886_pECC30-4 insolico UniProt ID   _
Length   107 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 107 a.a.        Molecular weight: 11943.78 Da        Isoelectric Point: 8.5732

>WP_180264886.1 MULTISPECIES: MobC family plasmid mobilization relaxosome protein [Enterobacter cloacae complex]
MLTMWVTEDEHRRLLERCEGRQLAAWMRQTCLDEKPARTGKLPSISPALLRQLAGMGNNLNQIARRVNAG
GGTGHDRVQIVAALMAIDAGLERLRHAVLEKGMDDDR

  Protein domains


Predicted by InterproScan.

(50-94)


  Protein structure



No available structure.




Host bacterium


ID   2257 GenBank   NZ_JAIEUG010000005
Plasmid name   pECC30-4 Incompatibility group   Col440II
Plasmid size   6365 bp Coordinate of oriT [Strand]   1178..1237 [+]
Host baterium   Enterobacter hormaechei strain ECC30

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -