Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   101805
Name   oriT_CF3W|unnamed4 in_silico
Organism   Enterobacter hormaechei strain CF3W
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_JACGGA010000023 (4019..4078 [-], 60 nt)
oriT length   60 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 60 nt

>oriT_CF3W|unnamed4
GGGTTTCGGGGCGCAGCCCTGAACCAGTCAAGTAGCGCTAGCGGAGTGTATACTGGCTTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   1511 GenBank   WP_205920559
Name   Relaxase_H4F72_RS23040_CF3W|unnamed4 insolico UniProt ID   _
Length   153 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 153 a.a.        Molecular weight: 17413.79 Da        Isoelectric Point: 6.2541

>WP_205920559.1 relaxase/mobilization nuclease domain-containing protein, partial [Enterobacter hormaechei]
MIVKFHPRGRGGGAGPVDYLLGKDRQREGASVLQGKPEEVRELIDASPYVKKYTSGVLSFAEADLPPGQR
EKLMASFERVLMPGLDKDQYSILWVEHEDKGRLELNFLIPNTELLTGRRLQPYYDRADRLRIDAWQTIVN
GRLELHDPNAPEN

  Protein domains


Predicted by InterproScan.

(57-129)


  Protein structure



No available structure.




Auxiliary protein


ID   605 GenBank   WP_007772081
Name   WP_007772081_CF3W|unnamed4 insolico UniProt ID   I7A6Y6
Length   107 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 107 a.a.        Molecular weight: 11885.64 Da        Isoelectric Point: 8.5732

>WP_007772081.1 MULTISPECIES: MobC family plasmid mobilization relaxosome protein [Bacteria]
MLTMWVTEDEHRRLLERCDGRQLAAWMRQTCLDEKPARSGKLPSISPALLRQLAGMGNNLNQIARRVNAG
GGTGHDRVQIVAALMAIDAGLERLRHAVLEKGTDDDR

  Protein domains


Predicted by InterproScan.

(50-94)


  Protein structure


Source ID Structure
AlphaFold DB I7A6Y6


Host bacterium


ID   2249 GenBank   NZ_JACGGA010000023
Plasmid name   CF3W|unnamed4 Incompatibility group   ColRNAI
Plasmid size   4962 bp Coordinate of oriT [Strand]   4019..4078 [-]
Host baterium   Enterobacter hormaechei strain CF3W

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -