Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   101689
Name   oriT_pEC121.C in_silico
Organism   Escherichia coli strain EC121
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_VYQD01000001 (11654..11758 [-], 105 nt)
oriT length   105 nt
IRs (inverted repeats)      32..37, 40..45  (GCCGGC..GCCGGC)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 105 nt

>oriT_pEC121.C
AGTACGGGACAAGATGTGTTTTTGGTACACCGCCGGCACGCCGGCAGTGACGCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTAT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   1457 GenBank   WP_004206924
Name   Relaxase_F4W56_RS00060_pEC121.C insolico UniProt ID   A0A2V4FJ40
Length   659 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75087.84 Da        Isoelectric Point: 10.0285

>WP_004206924.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFAGIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQLRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(86-334)


  Protein structure


Source ID Structure
AlphaFold DB A0A2V4FJ40


T4CP

ID   1132 GenBank   WP_004206885
Name   t4cp2_F4W56_RS00355_pEC121.C insolico UniProt ID   _
Length   695 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 695 a.a.        Molecular weight: 79538.91 Da        Isoelectric Point: 4.8317

>WP_004206885.1 MULTISPECIES: conjugal transfer protein TrbC [Enterobacterales]
MQQESVDSKKVLRPDGSFMEWFLTPNVQFGLLAILTVLGLFLPFTMLLSILILPPLMVAFTDRKFRPPLR
MPKDCEMFDDTLTTETQAEYRLGPIRIPHKVRERKKAKGILYVGYERGRLFGRELWLNMTDLLRHMVFFG
TTGSGKTETFYGFIVNFLLWCRGYCLSDGKADNKLAFATWSLARRFGREDDYYVLNLLTGSIDRFVNLVK
QESIPAQSNSVNLFSVAPPTFIIQLMESMLPQVGGDSAQWQDTAKAMMSALINALCYKRARGELLLSQRT
IQKNMSLPAMAALYVEAKKNGWHSEGYAALESYLENTPGFLLANAEYPETWEARAFEQHNYMSRQFLKTL
SLFNETYGHVFPEDSGDIRMDDIFHNDRILIVMIPSLELSRGEAATLGRLYVTLQRMTISKDLGYQLEGK
KEEVLLTHALNNQAPYGLIYDELGQYFTSGMDTLSAQMRSLEKMGVFSSQDHPSLARGANGEVDSLIANT
RVKYFESIEDRKTFEILRETVGQDYYSELSGQEAEHGTFSKTVREGDLYQIREKDRVNIRELRKQTEGQG
VISFQDALVRSAAFYIPDNEKFSSELPMRINRFIEVLPPSPATLYSIYPERKDDELAETNPDAMRFPPIK
LFGYDKAANSLLEKIEVFYELQCGAISPEEMSVCLFELFAEWLDGTETDDVLYHQEDDLFPMIEM

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 309..8856

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
F4W56_RS00010 309..1460 - 1152 WP_015062843 DotH/IcmK family type IV secretion protein traN
F4W56_RS00015 1469..2182 - 714 WP_223294958 DotI/IcmL family type IV secretion protein traM
F4W56_RS00020 2250..2660 + 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
F4W56_RS00025 2689..2844 + 156 WP_172693602 Hha/YmoA family nucleoid-associated regulatory protein -
F4W56_RS00030 2845..3357 - 513 WP_011091071 hypothetical protein traL
F4W56_RS25590 3323..6628 - 3306 WP_219818010 LPD7 domain-containing protein -
F4W56_RS00040 6653..6913 - 261 WP_004187310 IcmT/TraK family protein traK
F4W56_RS00045 6903..8066 - 1164 WP_004206926 plasmid transfer ATPase TraJ virB11
F4W56_RS00050 8077..8856 - 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
F4W56_RS00055 8853..9353 - 501 WP_004206925 DotD/TraH family lipoprotein -
F4W56_RS00060 9367..11346 - 1980 WP_004206924 TraI/MobA(P) family conjugative relaxase -
F4W56_RS00065 11333..11650 - 318 WP_004206923 plasmid mobilization protein MobA -
F4W56_RS00070 11926..12291 + 366 WP_004206922 hypothetical protein -
F4W56_RS00075 12792..13328 - 537 WP_004206920 hypothetical protein -
F4W56_RS00080 13461..13772 - 312 WP_004187333 hypothetical protein -

Region 2: 47045..64374

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
F4W56_RS00305 42738..43931 + 1194 WP_032449369 enoyl-ACP reductase FabV -
F4W56_RS00310 44065..44331 - 267 WP_009654924 HPr family phosphocarrier protein -
F4W56_RS00315 44347..44730 - 384 WP_052684238 DAK2 domain-containing protein -
F4W56_RS00320 44746..45078 - 333 WP_004187427 type II toxin-antitoxin system toxin endoribonuclease PemK-mt -
F4W56_RS00325 45080..45337 - 258 WP_004187429 type II toxin-antitoxin system antitoxin PemI -
F4W56_RS00330 45429..46082 - 654 WP_004206890 type II CAAX endopeptidase family protein -
F4W56_RS00335 46195..46545 + 351 WP_021526648 DUF1496 domain-containing protein -
F4W56_RS00340 46650..47045 + 396 WP_004187436 lytic transglycosylase domain-containing protein -
F4W56_RS00345 47045..48352 + 1308 WP_015059988 hypothetical protein trbA
F4W56_RS00350 48363..49313 + 951 WP_004206886 DsbC family protein trbB
F4W56_RS00355 49326..51413 + 2088 WP_004206885 conjugal transfer protein TrbC -
F4W56_RS25990 51464..51559 - 96 WP_004206884 DinQ-like type I toxin DqlB -
F4W56_RS00360 52786..53841 - 1056 WP_021526650 plasmid replication initiator RepA -
F4W56_RS00365 54138..54368 - 231 WP_004187496 IncL/M type plasmid replication protein RepC -
F4W56_RS00370 54442..55095 - 654 WP_004206935 hypothetical protein -
F4W56_RS00375 55098..57278 - 2181 WP_004187492 DotA/TraY family protein traY
F4W56_RS00380 57271..57921 - 651 WP_004187488 hypothetical protein -
F4W56_RS00385 57918..59126 - 1209 WP_004187486 conjugal transfer protein TraW traW
F4W56_RS00390 59123..62173 - 3051 WP_011154474 conjugative transfer protein traU
F4W56_RS00395 62170..62664 - 495 WP_004187480 hypothetical protein -
F4W56_RS00400 62710..63099 - 390 WP_011154472 DUF6750 family protein traR
F4W56_RS00405 63116..63646 - 531 WP_004187478 conjugal transfer protein TraQ traQ
F4W56_RS00410 63670..64374 - 705 WP_004206933 conjugal transfer protein TraP traP

Host bacterium

ID   2133 GenBank   NZ_VYQD01000001
Plasmid name   pEC121.C Incompatibility group   IncL/M
Plasmid size   65565 bp Coordinate of oriT [Strand]   11654..11758 [-]
Host baterium   Escherichia coli strain EC121

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -