Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   101688
Name   oriT_pCOL701T in_silico
Organism   Escherichia coli strain COL701
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_VMKR01000024 (43468..43520 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pCOL701T
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   1131 GenBank   WP_015059539
Name   t4cp2_FPQ08_RS16530_pCOL701T insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73404.02 Da        Isoelectric Point: 9.4339

>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 1688..24518

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FPQ08_RS16480 (FPQ08_16570) 1..1036 - 1036 WP_000750512 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
FPQ08_RS16485 (FPQ08_16575) 1049..1684 - 636 WP_000934977 A24 family peptidase -
FPQ08_RS16490 (FPQ08_16580) 1688..2170 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
FPQ08_RS16495 (FPQ08_16585) 2236..2799 - 564 WP_034169414 type 4 pilus major pilin -
FPQ08_RS16500 (FPQ08_16590) 2849..3958 - 1110 WP_000974903 type II secretion system F family protein -
FPQ08_RS16505 (FPQ08_16595) 3949..5487 - 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
FPQ08_RS16510 (FPQ08_16600) 5512..6006 - 495 WP_000912553 type IV pilus biogenesis protein PilP -
FPQ08_RS16515 (FPQ08_16605) 5990..7300 - 1311 WP_001454111 type 4b pilus protein PilO2 -
FPQ08_RS16520 (FPQ08_16610) 7351..8994 - 1644 WP_001035592 PilN family type IVB pilus formation outer membrane protein -
FPQ08_RS16525 (FPQ08_16615) 8987..9523 - 537 WP_001220543 sigma 54-interacting transcriptional regulator virb4
FPQ08_RS16530 (FPQ08_16620) 9570..11528 - 1959 WP_015059539 type IV secretory system conjugative DNA transfer family protein -
FPQ08_RS16535 (FPQ08_16625) 11544..12599 - 1056 WP_001542006 P-type DNA transfer ATPase VirB11 virB11
FPQ08_RS16540 (FPQ08_16630) 12618..13757 - 1140 WP_034169415 TrbI/VirB10 family protein virB10
FPQ08_RS16545 (FPQ08_16635) 13747..14448 - 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
FPQ08_RS16550 (FPQ08_16640) 14514..15248 - 735 WP_000432282 type IV secretion system protein virB8
FPQ08_RS16555 (FPQ08_16650) 15414..17771 - 2358 WP_000548950 VirB4 family type IV secretion system protein virb4
FPQ08_RS16560 (FPQ08_16655) 17777..18097 - 321 WP_000362080 VirB3 family type IV secretion system protein virB3
FPQ08_RS22595 18168..18458 - 291 WP_000865479 conjugal transfer protein -
FPQ08_RS16570 (FPQ08_16665) 18458..19042 - 585 WP_001177117 lytic transglycosylase domain-containing protein virB1
FPQ08_RS16575 (FPQ08_16670) 19063..19461 - 399 WP_001153669 hypothetical protein -
FPQ08_RS16580 (FPQ08_16675) 19580..20017 - 438 WP_034169416 type IV pilus biogenesis protein PilM -
FPQ08_RS16585 (FPQ08_16680) 20023..21258 - 1236 WP_034169417 toxin co-regulated pilus biosynthesis Q family protein -
FPQ08_RS16590 (FPQ08_16685) 21261..21560 - 300 WP_000835763 TrbM/KikA/MpfK family conjugal transfer protein -
FPQ08_RS16595 (FPQ08_16690) 21608..22417 + 810 WP_024237698 DUF5710 domain-containing protein -
FPQ08_RS16600 (FPQ08_16695) 22640..22864 - 225 WP_000713562 EexN family lipoprotein -
FPQ08_RS16605 (FPQ08_16700) 22873..23517 - 645 WP_001310442 type IV secretion system protein -
FPQ08_RS16610 (FPQ08_16705) 23523..24518 - 996 WP_001028540 type IV secretion system protein virB6
FPQ08_RS16615 (FPQ08_16710) 24522..24779 - 258 WP_000739144 hypothetical protein -
FPQ08_RS16620 (FPQ08_16715) 24776..25078 - 303 WP_001360345 hypothetical protein -
FPQ08_RS22280 (FPQ08_16720) 25059..25316 - 258 WP_001542015 hypothetical protein -
FPQ08_RS16625 (FPQ08_16725) 25349..25795 - 447 WP_001243165 hypothetical protein -
FPQ08_RS22285 25806..25976 - 171 WP_000550720 hypothetical protein -
FPQ08_RS16630 (FPQ08_16730) 25980..26423 - 444 WP_000964330 NfeD family protein -
FPQ08_RS16635 (FPQ08_16740) 26797..27750 - 954 WP_072089442 SPFH domain-containing protein -
FPQ08_RS22290 27777..27953 - 177 WP_000753050 hypothetical protein -
FPQ08_RS16640 (FPQ08_16745) 27946..28161 - 216 WP_001127357 DUF1187 family protein -
FPQ08_RS16645 (FPQ08_16750) 28154..28606 - 453 WP_000101552 CaiF/GrlA family transcriptional regulator -


Host bacterium


ID   2132 GenBank   NZ_VMKR01000024
Plasmid name   pCOL701T Incompatibility group   IncI2
Plasmid size   59087 bp Coordinate of oriT [Strand]   43468..43520 [-]
Host baterium   Escherichia coli strain COL701

Cargo genes


Drug resistance gene   mcr-1.1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -