Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   101675
Name   oriT_p211DT2019_3 in_silico
Organism   Klebsiella michiganensis strain CPE5
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_JACYGO010000004 (4205..4254 [+], 50 nt)
oriT length   50 nt
IRs (inverted repeats)      7..14, 17..24  (GCAAAATT..AATTTTGC)
Location of nic site      33..34
Conserved sequence flanking the
  nic site    		  TGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 50 nt

>oriT_p211DT2019_3
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein

ID   575 GenBank   WP_053390193
Name   WP_053390193_p211DT2019_3 insolico UniProt ID   A0A8G2A327
Length   130 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 130 a.a.        Molecular weight: 14883.89 Da        Isoelectric Point: 4.3779

>WP_053390193.1 MULTISPECIES: conjugal transfer relaxosome DNA-binding protein TraM [Enterobacteriaceae]
MAKVQAYVSDEVADKINAIVEKRRVEGAKDKDISFSSISTMLLELGLRVYEAQMERKESGFNQMAFNKAL
LESVIKTQFTVNKVLGIECLSPHVSGNPRWEWPGLIENIRDDVQEVMLRFFPDEESEDEE

  Protein domains


Predicted by InterproScan.

TraM protein, DNA-binding (Tra_M)

(1-125)


  Protein structure



No available structure.




T4CP

ID   1124 GenBank   WP_075606915
Name   traD_IY169_RS01640_p211DT2019_3 insolico UniProt ID   _
Length   772 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 772 a.a.        Molecular weight: 86712.47 Da        Isoelectric Point: 5.0825

>WP_075606915.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFIIFWVLCGLILMYRLSWQTFVNGCVYWWCTTLAPMR
DIIRSQPVYTINYYGKSLEYNSEQILADKYTIWCGEQLWTSFVFAAIVSLTVCIVTFFVASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKHSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDIWRECLTLPDFDNVSNTLIPMGTKEDPFWQG
SGRTIFSEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLKNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDQPNGWLFISSNADTHASLKPVISMWLSIAIRGLLGMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKSRPKIAEGFILRNLDTRTDARLDTLLEAREAESSHARTLFTPDAPAPELAEKDEKVGNPPEQSQPAE
SSGTPATVKVPSTAKTPEADESGQSPEVSNPAALLTKVVTVPLTRPRPAAATGTAAVASATDVRATPAGG
TEQALETQPAEQGQDMLPPGVNEYGEIDDMHAWDEWQSGEQTQRDMQRREEVNINHSHRRDEQDDIEIGG
NF

  Protein domains


Predicted by InterproScan.

F sex factor protein N terminal (TraD_N)

(32-128)

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(172-560)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 82246..105012

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
IY169_RS01640 82246..84564 - 2319 WP_075606915 type IV conjugative transfer system coupling protein TraD virb4
IY169_RS30105 84683..85375 - 693 WP_202395549 hypothetical protein -
IY169_RS01650 85567..86298 - 732 WP_064386198 conjugal transfer complement resistance protein TraT -
IY169_RS01655 86657..87325 - 669 WP_128317877 hypothetical protein -
IY169_RS01660 87342..90221 - 2880 WP_064386194 conjugal transfer mating-pair stabilization protein TraG traG
IY169_RS01665 90221..91591 - 1371 WP_075606918 conjugal transfer pilus assembly protein TraH traH
IY169_RS01670 91578..92138 - 561 WP_039698500 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
IY169_RS01675 92113..92349 - 237 WP_053390221 type-F conjugative transfer system pilin chaperone TraQ -
IY169_RS01680 92360..93112 - 753 WP_053390220 type-F conjugative transfer system pilin assembly protein TraF traF
IY169_RS01685 93133..93459 - 327 WP_053390219 hypothetical protein -
IY169_RS01690 93505..93747 - 243 WP_053390218 conjugal transfer protein TrbE -
IY169_RS01695 93737..94348 - 612 WP_053390217 hypothetical protein -
IY169_RS01700 94341..94601 - 261 WP_053390216 hypothetical protein -
IY169_RS01705 94633..96588 - 1956 WP_064343537 type-F conjugative transfer system mating-pair stabilization protein TraN traN
IY169_RS01710 96585..96968 - 384 WP_053390297 hypothetical protein -
IY169_RS01715 96965..97612 - 648 WP_064343536 type-F conjugative transfer system pilin assembly protein TrbC trbC
IY169_RS01720 97625..98584 - 960 WP_229295972 conjugal transfer pilus assembly protein TraU traU
IY169_RS01725 98628..99254 - 627 WP_064343535 type-F conjugative transfer system protein TraW traW
IY169_RS01730 99251..99643 - 393 WP_064343534 type-F conjugative transfer system protein TrbI -
IY169_RS01735 99643..102282 - 2640 WP_064343533 type IV secretion system protein TraC virb4
IY169_RS01740 102375..102758 - 384 WP_042946290 hypothetical protein -
IY169_RS01745 102846..103145 - 300 WP_053390308 hypothetical protein -
IY169_RS30110 103142..103543 - 402 WP_064343532 hypothetical protein -
IY169_RS01755 103627..103815 - 189 WP_053390286 hypothetical protein -
IY169_RS01760 104428..105012 - 585 WP_064343530 type IV conjugative transfer system lipoprotein TraV traV
IY169_RS01765 105046..105480 - 435 WP_020322358 conjugal transfer protein TraP -

Host bacterium

ID   2119 GenBank   NZ_JACYGO010000004
Plasmid name   p211DT2019_3 Incompatibility group   IncFII
Plasmid size   106709 bp Coordinate of oriT [Strand]   4205..4254 [+]
Host baterium   Klebsiella michiganensis strain CPE5

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -