Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 101663 |
| Name | oriT_pA4sk5_2 |
| Organism | Klebsiella pneumoniae strain CPE8 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_JACYGR010000003 (104334..104383 [-], 50 nt) |
| oriT length | 50 nt |
| IRs (inverted repeats) | 7..14, 17..24 (GCAAAATT..AATTTTGC) |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 50 nt
>oriT_pA4sk5_2
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTCATTTTGTGGTGAG
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTCATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 1115 | GenBank | WP_004152620 |
| Name | traD_IYX25_RS26850_pA4sk5_2 |
UniProt ID | _ |
| Length | 770 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 770 a.a. Molecular weight: 85871.84 Da Isoelectric Point: 5.0101
>WP_004152620.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacterales]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFAFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDTPEPGPADTDSHASEQPEPVSPPA
PAVMTVTPAPVKSPPTTKRPAAEPSVRATEPPVLRGTTVPLIKPKAAAAATAASTASSAGAPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFAFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDTPEPGPADTDSHASEQPEPVSPPA
PAVMTVTPAPVKSPPTTKRPAAEPSVRATEPPVLRGTTVPLIKPKAAAAATAASTASSAGAPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 392..16914
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IYX25_RS26765 | 3..392 | + | 390 | WP_004152591 | type-F conjugative transfer system protein TrbI | - |
| IYX25_RS26770 | 392..1018 | + | 627 | WP_004152507 | type-F conjugative transfer system protein TraW | traW |
| IYX25_RS26775 | 1060..1449 | + | 390 | WP_004152508 | hypothetical protein | - |
| IYX25_RS26780 | 1446..2435 | + | 990 | WP_011977785 | conjugal transfer pilus assembly protein TraU | traU |
| IYX25_RS26785 | 2448..3086 | + | 639 | WP_004152672 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| IYX25_RS26790 | 3145..5100 | + | 1956 | WP_194849827 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| IYX25_RS26795 | 5132..5368 | + | 237 | WP_004152683 | conjugal transfer protein TrbE | - |
| IYX25_RS27875 | 5365..5550 | + | 186 | WP_004152684 | hypothetical protein | - |
| IYX25_RS26800 | 5596..5922 | + | 327 | WP_004152685 | hypothetical protein | - |
| IYX25_RS26805 | 5943..6695 | + | 753 | WP_004152686 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| IYX25_RS26810 | 6706..6945 | + | 240 | WP_004152687 | type-F conjugative transfer system pilin chaperone TraQ | - |
| IYX25_RS26815 | 6917..7489 | + | 573 | WP_004152688 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| IYX25_RS26820 | 7482..7910 | + | 429 | WP_004152689 | hypothetical protein | - |
| IYX25_RS26825 | 7897..9267 | + | 1371 | WP_004178055 | conjugal transfer pilus assembly protein TraH | traH |
| IYX25_RS26830 | 9267..12116 | + | 2850 | WP_072242275 | conjugal transfer mating-pair stabilization protein TraG | traG |
| IYX25_RS26835 | 12129..12677 | + | 549 | WP_004152623 | conjugal transfer entry exclusion protein TraS | - |
| IYX25_RS26840 | 12861..13592 | + | 732 | WP_004152622 | conjugal transfer complement resistance protein TraT | - |
| IYX25_RS26845 | 13784..14473 | + | 690 | WP_004198206 | hypothetical protein | - |
| IYX25_RS26850 | 14602..16914 | + | 2313 | WP_004152620 | type IV conjugative transfer system coupling protein TraD | virb4 |
Region 2: 103776..111827
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IYX25_RS27310 | 98793..99143 | + | 351 | WP_004152758 | hypothetical protein | - |
| IYX25_RS27315 | 99779..100135 | + | 357 | WP_004152717 | hypothetical protein | - |
| IYX25_RS27320 | 100196..100408 | + | 213 | WP_004152718 | hypothetical protein | - |
| IYX25_RS27325 | 100419..100643 | + | 225 | WP_004152719 | hypothetical protein | - |
| IYX25_RS27330 | 100724..101044 | + | 321 | WP_004152720 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| IYX25_RS27335 | 101034..101312 | + | 279 | WP_004152721 | helix-turn-helix transcriptional regulator | - |
| IYX25_RS27340 | 101313..101726 | + | 414 | WP_004152722 | helix-turn-helix domain-containing protein | - |
| IYX25_RS27345 | 102560..103381 | + | 822 | WP_004178064 | DUF932 domain-containing protein | - |
| IYX25_RS27350 | 103414..103743 | + | 330 | WP_011977736 | DUF5983 family protein | - |
| IYX25_RS27355 | 103776..104261 | - | 486 | WP_004178063 | transglycosylase SLT domain-containing protein | virB1 |
| IYX25_RS27360 | 104695..105087 | + | 393 | WP_004178062 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| IYX25_RS27365 | 105301..105996 | + | 696 | WP_004178061 | transcriptional regulator TraJ family protein | - |
| IYX25_RS27370 | 106080..106451 | + | 372 | WP_004208838 | TraY domain-containing protein | - |
| IYX25_RS27885 | 106489..106686 | - | 198 | WP_306426809 | hypothetical protein | - |
| IYX25_RS27375 | 106668..107648 | - | 981 | WP_000019473 | IS5-like element ISKpn26 family transposase | - |
| IYX25_RS27380 | 107702..108073 | + | 372 | WP_086071064 | type IV conjugative transfer system pilin TraA | - |
| IYX25_RS27385 | 108087..108392 | + | 306 | WP_004178059 | type IV conjugative transfer system protein TraL | traL |
| IYX25_RS27390 | 108412..108978 | + | 567 | WP_004144423 | type IV conjugative transfer system protein TraE | traE |
| IYX25_RS27395 | 108965..109705 | + | 741 | WP_004152497 | type-F conjugative transfer system secretin TraK | traK |
| IYX25_RS27400 | 109705..111129 | + | 1425 | WP_004155033 | F-type conjugal transfer pilus assembly protein TraB | traB |
| IYX25_RS27405 | 111243..111827 | + | 585 | WP_004161368 | type IV conjugative transfer system lipoprotein TraV | traV |
| IYX25_RS27410 | 111959..112369 | + | 411 | WP_004152499 | hypothetical protein | - |
| IYX25_RS27415 | 112475..112693 | + | 219 | WP_004152501 | hypothetical protein | - |
| IYX25_RS27420 | 112694..113005 | + | 312 | WP_004152502 | hypothetical protein | - |
| IYX25_RS27425 | 113072..113479 | + | 408 | WP_194849826 | hypothetical protein | - |
| IYX25_RS27430 | 113522..113911 | + | 390 | WP_004153076 | hypothetical protein | - |
| IYX25_RS27435 | 113919..114317 | + | 399 | WP_011977783 | hypothetical protein | - |
Host bacterium
| ID | 2107 | GenBank | NZ_JACYGR010000003 |
| Plasmid name | pA4sk5_2 | Incompatibility group | IncFII |
| Plasmid size | 117025 bp | Coordinate of oriT [Strand] | 104334..104383 [-] |
| Host baterium | Klebsiella pneumoniae strain CPE8 |
Cargo genes
| Drug resistance gene | blaKPC-3, blaOXA-9, blaTEM-1A |
| Virulence gene | - |
| Metal resistance gene | merE, merD, merA |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | AcrIE9 |