Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   101660
Name   oriT_pA7sk2_1 in_silico
Organism   Citrobacter freundii strain CPE2
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_JACYGL010000003 (63312..63417 [+], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      30..35, 41..46  (CCGCCG..CGGCGG)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 106 nt

>oriT_pA7sk2_1
AGTACGGGACAAGATGTGTTTTTGGAGTACCGCCGACACGCGGCGGCCGTCCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTATCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   1114 GenBank   WP_004206885
Name   t4cp2_IY229_RS22840_pA7sk2_1 insolico UniProt ID   _
Length   695 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 695 a.a.        Molecular weight: 79538.91 Da        Isoelectric Point: 4.8317

>WP_004206885.1 MULTISPECIES: conjugal transfer protein TrbC [Enterobacterales]
MQQESVDSKKVLRPDGSFMEWFLTPNVQFGLLAILTVLGLFLPFTMLLSILILPPLMVAFTDRKFRPPLR
MPKDCEMFDDTLTTETQAEYRLGPIRIPHKVRERKKAKGILYVGYERGRLFGRELWLNMTDLLRHMVFFG
TTGSGKTETFYGFIVNFLLWCRGYCLSDGKADNKLAFATWSLARRFGREDDYYVLNLLTGSIDRFVNLVK
QESIPAQSNSVNLFSVAPPTFIIQLMESMLPQVGGDSAQWQDTAKAMMSALINALCYKRARGELLLSQRT
IQKNMSLPAMAALYVEAKKNGWHSEGYAALESYLENTPGFLLANAEYPETWEARAFEQHNYMSRQFLKTL
SLFNETYGHVFPEDSGDIRMDDIFHNDRILIVMIPSLELSRGEAATLGRLYVTLQRMTISKDLGYQLEGK
KEEVLLTHALNNQAPYGLIYDELGQYFTSGMDTLSAQMRSLEKMGVFSSQDHPSLARGANGEVDSLIANT
RVKYFESIEDRKTFEILRETVGQDYYSELSGQEAEHGTFSKTVREGDLYQIREKDRVNIRELRKQTEGQG
VISFQDALVRSAAFYIPDNEKFSSELPMRINRFIEVLPPSPATLYSIYPERKDDELAETNPDAMRFPPIK
LFGYDKAANSLLEKIEVFYELQCGAISPEEMSVCLFELFAEWLDGTETDDVLYHQEDDLFPMIEM

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 2538..29881

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
IY229_RS22725 48..2027 + 1980 WP_004187323 TraI/MobA(P) family conjugative relaxase -
IY229_RS22730 2041..2541 + 501 WP_004187320 DotD/TraH family lipoprotein -
IY229_RS22735 2538..3317 + 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
IY229_RS22740 3328..4491 + 1164 WP_004187313 plasmid transfer ATPase TraJ virB11
IY229_RS22745 4481..4741 + 261 WP_004187310 IcmT/TraK family protein traK
IY229_RS23245 4766..8203 + 3438 WP_015586048 LPD7 domain-containing protein -
IY229_RS22755 8169..8681 + 513 WP_011091071 hypothetical protein traL
IY229_RS22760 8682..8894 - 213 WP_305953721 Hha/YmoA family nucleoid-associated regulatory protein -
IY229_RS22765 8866..9276 - 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
IY229_RS22770 9344..10057 + 714 WP_004187467 DotI/IcmL family type IV secretion protein traM
IY229_RS22775 10066..11217 + 1152 WP_004187471 DotH/IcmK family type IV secretion protein traN
IY229_RS22780 11229..12578 + 1350 WP_004187474 conjugal transfer protein TraO traO
IY229_RS22785 12590..13294 + 705 WP_015060002 conjugal transfer protein TraP traP
IY229_RS22790 13318..13848 + 531 WP_004187478 conjugal transfer protein TraQ traQ
IY229_RS22795 13865..14254 + 390 WP_004187479 DUF6750 family protein traR
IY229_RS22800 14300..14794 + 495 WP_004187480 hypothetical protein -
IY229_RS22805 14791..17841 + 3051 WP_004187482 hypothetical protein traU
IY229_RS22810 17838..19046 + 1209 WP_011091082 conjugal transfer protein TraW traW
IY229_RS22815 19043..19639 + 597 WP_032419542 hypothetical protein -
IY229_RS22820 19632..21827 + 2196 WP_015062834 DotA/TraY family protein traY
IY229_RS22825 21829..22482 + 654 WP_015060005 hypothetical protein -
IY229_RS22830 22563..22793 + 231 WP_011091085 IncL/M type plasmid replication protein RepC -
IY229_RS22835 23089..24144 + 1056 WP_015060006 plasmid replication initiator RepA -
IY229_RS23285 25367..25462 + 96 WP_004206884 DinQ-like type I toxin DqlB -
IY229_RS22840 25513..27600 - 2088 WP_004206885 conjugal transfer protein TrbC -
IY229_RS22845 27613..28563 - 951 WP_004206886 DsbC family protein trbB
IY229_RS22850 28574..29881 - 1308 WP_015059988 hypothetical protein trbA
IY229_RS22855 29881..30276 - 396 WP_004187436 lytic transglycosylase domain-containing protein -
IY229_RS22860 30381..30731 - 351 WP_124065455 DUF1496 domain-containing protein -
IY229_RS22865 30844..31278 + 435 Protein_30 CPBP family intramembrane glutamate endopeptidase -
IY229_RS22870 31293..32498 - 1206 WP_025987686 IS4-like element IS10A family transposase -
IY229_RS22880 33411..34208 + 798 WP_015059991 OXA-48 family carbapenem-hydrolyzing class D beta-lactamase OXA-48 -

Host bacterium

ID   2104 GenBank   NZ_JACYGL010000003
Plasmid name   pA7sk2_1 Incompatibility group   IncL/M
Plasmid size   63675 bp Coordinate of oriT [Strand]   63312..63417 [+]
Host baterium   Citrobacter freundii strain CPE2

Cargo genes

Drug resistance gene   blaOXA-48
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -