Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 101659 |
| Name | oriT_pINSali25-MCR  |
| Organism | Escherichia coli strain INSali25 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_LSRK02000169 (47063..47115 [+], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pINSali25-MCR
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 1113 | GenBank | WP_077151052 |
| Name | t4cp2_AYC64_RS27505_pINSali25-MCR |
UniProt ID | _ |
| Length | 652 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73376.99 Da Isoelectric Point: 9.2523
>WP_077151052.1 type IV secretory system conjugative DNA transfer family protein [Escherichia coli]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 7006..31144
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AYC64_RS27365 (AYC64_027365) | 3293..3745 | + | 453 | WP_223666486 | CaiF/GrlA family transcriptional regulator | - |
| AYC64_RS27370 (AYC64_027370) | 3738..3953 | + | 216 | WP_001127357 | DUF1187 family protein | - |
| AYC64_RS27965 | 3946..4122 | + | 177 | WP_000753050 | hypothetical protein | - |
| AYC64_RS27375 (AYC64_027375) | 4149..5102 | + | 954 | WP_072097371 | SPFH domain-containing protein | - |
| AYC64_RS27385 (AYC64_027385) | 5488..5931 | + | 444 | WP_077151048 | NfeD family protein | - |
| AYC64_RS27970 | 5935..6105 | + | 171 | WP_044069355 | hypothetical protein | - |
| AYC64_RS27395 (AYC64_027395) | 6446..6748 | + | 303 | WP_001360345 | hypothetical protein | - |
| AYC64_RS27400 (AYC64_027400) | 6745..7002 | + | 258 | WP_000739144 | hypothetical protein | - |
| AYC64_RS27405 (AYC64_027405) | 7006..8001 | + | 996 | WP_065304446 | type IV secretion system protein | virB6 |
| AYC64_RS27410 (AYC64_027410) | 8007..8651 | + | 645 | WP_065304453 | type IV secretion system protein | - |
| AYC64_RS27415 (AYC64_027415) | 8660..8884 | + | 225 | WP_065304445 | EexN family lipoprotein | - |
| AYC64_RS27420 (AYC64_027420) | 9107..9916 | - | 810 | WP_172618082 | DUF5710 domain-containing protein | - |
| AYC64_RS27425 (AYC64_027425) | 9964..10599 | + | 636 | WP_015059536 | hypothetical protein | - |
| AYC64_RS27430 (AYC64_027430) | 10699..10950 | + | 252 | WP_000121741 | hypothetical protein | - |
| AYC64_RS27435 (AYC64_027435) | 10940..11221 | + | 282 | WP_000638823 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| AYC64_RS27440 (AYC64_027440) | 11289..11588 | + | 300 | WP_077151050 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| AYC64_RS27445 (AYC64_027445) | 11591..12826 | + | 1236 | WP_000733394 | TcpQ domain-containing protein | - |
| AYC64_RS27450 (AYC64_027450) | 12832..13269 | + | 438 | WP_000539665 | type IV pilus biogenesis protein PilM | - |
| AYC64_RS27455 (AYC64_027455) | 13388..13786 | + | 399 | WP_001153668 | hypothetical protein | - |
| AYC64_RS27460 (AYC64_027460) | 13807..14391 | + | 585 | WP_001177114 | lytic transglycosylase domain-containing protein | virB1 |
| AYC64_RS28620 | 14391..14681 | + | 291 | WP_000865479 | conjugal transfer protein | - |
| AYC64_RS27470 (AYC64_027470) | 14752..15072 | + | 321 | WP_000362080 | VirB3 family type IV secretion system protein | virB3 |
| AYC64_RS27475 (AYC64_027475) | 15078..17435 | + | 2358 | WP_077151051 | VirB4 family type IV secretion system protein | virb4 |
| AYC64_RS27485 (AYC64_027485) | 17601..18335 | + | 735 | WP_000432283 | type IV secretion system protein | virB8 |
| AYC64_RS27490 (AYC64_027490) | 18401..19102 | + | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| AYC64_RS27495 (AYC64_027495) | 19092..20231 | + | 1140 | WP_000790641 | TrbI/VirB10 family protein | virB10 |
| AYC64_RS27500 (AYC64_027500) | 20250..21305 | + | 1056 | WP_001059977 | P-type DNA transfer ATPase VirB11 | virB11 |
| AYC64_RS27505 (AYC64_027505) | 21321..23279 | + | 1959 | WP_077151052 | type IV secretory system conjugative DNA transfer family protein | - |
| AYC64_RS27510 (AYC64_027510) | 23326..23856 | + | 531 | WP_077151053 | sigma 54-interacting transcriptional regulator | virb4 |
| AYC64_RS27515 (AYC64_027515) | 23849..25492 | + | 1644 | WP_001035589 | PilN family type IVB pilus formation outer membrane protein | - |
| AYC64_RS27520 (AYC64_027520) | 25543..26853 | + | 1311 | WP_001454111 | type 4b pilus protein PilO2 | - |
| AYC64_RS27525 (AYC64_027525) | 26837..27331 | + | 495 | WP_000912553 | type IV pilus biogenesis protein PilP | - |
| AYC64_RS27530 (AYC64_027530) | 27356..28894 | + | 1539 | WP_000466225 | ATPase, T2SS/T4P/T4SS family | virB11 |
| AYC64_RS27535 (AYC64_027535) | 28885..29994 | + | 1110 | WP_000974903 | type II secretion system F family protein | - |
| AYC64_RS27540 (AYC64_027540) | 30039..30596 | + | 558 | WP_000095048 | type 4 pilus major pilin | - |
| AYC64_RS27545 (AYC64_027545) | 30662..31144 | + | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
| AYC64_RS27550 (AYC64_027550) | 31148..31783 | + | 636 | WP_000934977 | A24 family peptidase | - |
| AYC64_RS27555 (AYC64_027555) | 31796..33172 | + | 1377 | WP_000750519 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| AYC64_RS28880 (AYC64_027560) | 33169..33390 | - | 222 | Protein_40 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| AYC64_RS27575 (AYC64_027575) | 33825..34196 | + | 372 | WP_176478117 | pilus assembly protein | - |
| AYC64_RS27595 (AYC64_027595) | 34956..36080 | + | 1125 | WP_077151055 | site-specific integrase | - |
Host bacterium
| ID | 2103 | GenBank | NZ_LSRK02000169 |
| Plasmid name | pINSali25-MCR | Incompatibility group | IncI2 |
| Plasmid size | 54921 bp | Coordinate of oriT [Strand] | 47063..47115 [+] |
| Host baterium | Escherichia coli strain INSali25 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |