Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   101654
Name   oriT_pLV36464 in_silico
Organism   Escherichia coli strain LV36464
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_LRXI01000078 (2157..2280 [+], 124 nt)
oriT length   124 nt
IRs (inverted repeats)      92..99, 113..120  (ATAATGTA..TACATTAT)
 90..95, 107..112  (AAATAA..TTATTT)
 39..46, 49..56  (GCAAAAAC..GTTTTTGC)
 3..10, 15..22  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 124 nt

>oriT_pLV36464
GGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTGCTATTTGAATCATTAACTTATGTTTTAAATAATGTATTTTAATTTATTTTACATTATAAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   1106 GenBank   WP_001064239
Name   traC_AXE68_RS18655_pLV36464 insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99485.47 Da        Isoelectric Point: 6.6265

>WP_001064239.1 MULTISPECIES: type IV secretion system protein TraC [Enterobacteriaceae]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAAA
TQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASFHGAKITTQTVDAQAFIEIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNMADNYSNLLNPEMSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFKGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKKKQARIDDVVDFLKNARDNDQYVESPTIRSRLDEMIVLLDQYT
ANGTYGRYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRTLKKLNVIDEGWR
LLDFKNRKVGEFIQKGYRTCRRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLFPDQFQPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRREGM
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

(467-771)

(290-446)

(38-276)

  Protein structure



No available structure.



ID   1107 GenBank   WP_061103957
Name   traD_AXE68_RS18745_pLV36464 insolico UniProt ID   _
Length   717 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 717 a.a.        Molecular weight: 81527.17 Da        Isoelectric Point: 5.1048

>WP_061103957.1 type IV conjugative transfer system coupling protein TraD [Escherichia coli]
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILVGLVLWVKISWQTFVNGCIYWWCTTLEGMR
DLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLASVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTDNPKDVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVSTGKSEVIRRLANYAR
KRGDMVVIYDRSCEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNVANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGEPFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVVSMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVLNTRAFFRSPSHQIA
EFAAGEIGEKEHLKASLQYSYGADPVRDGISTGKEMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQARPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPDVPEVVSGEDVTQAEQPQQPVSPAI
NDKKSDSGVNIPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAAYEAWQQENHPDIQQQMQRREEVN
INVHRERGEDVEPGDDF

  Protein domains


Predicted by InterproScan.

(32-128)

(173-560)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 1585..23996

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AXE68_RS18580 (AXE68_22355) 73..360 + 288 WP_000107537 hypothetical protein -
AXE68_RS18585 (AXE68_22360) 481..1302 + 822 WP_001234469 DUF932 domain-containing protein -
AXE68_RS18590 (AXE68_22365) 1585..2232 - 648 WP_000614282 transglycosylase SLT domain-containing protein virB1
AXE68_RS18595 (AXE68_22370) 2518..2901 + 384 WP_001151564 conjugal transfer relaxosome DNA-binding protein TraM -
AXE68_RS18600 (AXE68_22375) 3095..3781 + 687 WP_000332487 PAS domain-containing protein -
AXE68_RS18605 (AXE68_22380) 3875..4102 + 228 WP_001254388 conjugal transfer relaxosome protein TraY -
AXE68_RS18610 (AXE68_22385) 4136..4498 + 363 WP_001098998 type IV conjugative transfer system pilin TraA -
AXE68_RS18615 (AXE68_22390) 4503..4814 + 312 WP_000012106 type IV conjugative transfer system protein TraL traL
AXE68_RS18620 (AXE68_22395) 4836..5402 + 567 WP_000399804 type IV conjugative transfer system protein TraE traE
AXE68_RS18625 (AXE68_22400) 5389..6117 + 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
AXE68_RS18630 (AXE68_22405) 6117..7544 + 1428 WP_000146638 F-type conjugal transfer pilus assembly protein TraB traB
AXE68_RS18635 (AXE68_22410) 7534..8118 + 585 WP_000002795 conjugal transfer pilus-stabilizing protein TraP -
AXE68_RS18640 (AXE68_22415) 8105..8425 + 321 WP_001057302 conjugal transfer protein TrbD virb4
AXE68_RS18645 (AXE68_22420) 8418..8669 + 252 WP_001038341 conjugal transfer protein TrbG -
AXE68_RS18650 (AXE68_22425) 8666..9181 + 516 WP_000809893 type IV conjugative transfer system lipoprotein TraV traV
AXE68_RS28015 9316..9537 + 222 WP_001278978 conjugal transfer protein TraR -
AXE68_RS18655 (AXE68_22430) 9697..12324 + 2628 WP_001064239 type IV secretion system protein TraC virb4
AXE68_RS18660 (AXE68_22435) 12321..12707 + 387 WP_000214082 type-F conjugative transfer system protein TrbI -
AXE68_RS18665 (AXE68_22440) 12704..13336 + 633 WP_001203720 type-F conjugative transfer system protein TraW traW
AXE68_RS18670 (AXE68_22445) 13333..14325 + 993 WP_000830838 conjugal transfer pilus assembly protein TraU traU
AXE68_RS18675 (AXE68_22450) 14355..14660 + 306 WP_000224411 hypothetical protein -
AXE68_RS18680 (AXE68_22455) 14669..15283 + 615 WP_061103956 type-F conjugative transfer system pilin assembly protein TrbC trbC
AXE68_RS18685 (AXE68_22460) 15207..16859 + 1653 WP_225104490 type-F conjugative transfer system mating-pair stabilization protein TraN traN
AXE68_RS18690 (AXE68_22465) 16886..17143 + 258 WP_000864320 conjugal transfer protein TrbE -
AXE68_RS18695 (AXE68_22470) 17136..17879 + 744 WP_001030371 type-F conjugative transfer system pilin assembly protein TraF traF
AXE68_RS18700 (AXE68_22475) 17895..18233 + 339 WP_001287905 conjugal transfer protein TrbA -
AXE68_RS18705 (AXE68_22480) 18360..18644 + 285 WP_001448202 type-F conjugative transfer system pilin chaperone TraQ -
AXE68_RS18710 (AXE68_22485) 18631..19176 + 546 WP_000059824 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
AXE68_RS18715 (AXE68_22490) 19106..19447 + 342 WP_001448115 P-type conjugative transfer protein TrbJ -
AXE68_RS18720 (AXE68_22495) 19428..19820 + 393 WP_000660703 F-type conjugal transfer protein TrbF -
AXE68_RS18725 (AXE68_22500) 19807..21180 + 1374 WP_001137364 conjugal transfer pilus assembly protein TraH traH
AXE68_RS18730 (AXE68_22505) 21177..23996 + 2820 WP_001007057 conjugal transfer mating-pair stabilization protein TraG traG
AXE68_RS18735 (AXE68_22510) 24015..24512 + 498 WP_000605861 hypothetical protein -
AXE68_RS18740 (AXE68_22515) 24544..25275 + 732 WP_000850422 conjugal transfer complement resistance protein TraT -
AXE68_RS18745 (AXE68_22520) 25528..27681 + 2154 WP_061103957 type IV conjugative transfer system coupling protein TraD -
AXE68_RS18750 (AXE68_22525) 27681..28685 + 1005 Protein_35 MobF family relaxase -


Host bacterium


ID   2098 GenBank   NZ_LRXI01000078
Plasmid name   pLV36464 Incompatibility group   -
Plasmid size   28700 bp Coordinate of oriT [Strand]   2157..2280 [+]
Host baterium   Escherichia coli strain LV36464

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -