Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   101646
Name   oriT_FWSEC0430|unnamed3 in_silico
Organism   Escherichia coli strain FWSEC0430
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_RROZ01000128 (58889..59011 [-], 123 nt)
oriT length   123 nt
IRs (inverted repeats)      92..99, 113..120  (ATAATGTA..TACATTAT)
 90..95, 107..112  (AAATAA..TTATTT)
 64..72, 86..94  (TATTTAAAA..TTTTAAATA)
 57..62, 70..75  (TGATTT..AAATCA)
 39..46, 49..56  (GCAAAAAC..GTTTTTGC)
 3..10, 15..22  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 123 nt

>oriT_FWSEC0430|unnamed3
GGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTGTATTTAAAATCATCATGTTATGTTTTAAATAATGTATTTTAATTTATTTTACATTATAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein

ID   566 GenBank   WP_001254389
Name   WP_001254389_FWSEC0430|unnamed3 insolico UniProt ID   _
Length   75 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 75 a.a.        Molecular weight: 9045.17 Da        Isoelectric Point: 10.2071

>WP_001254389.1 conjugal transfer relaxosome protein TraY [Escherichia coli]
MRRRNARGGISRTVSVYLDEDTNNRLIRAKDRSGRSKTIEVQIRLRDHLKRFPDFYNEEIFREVIEESES
TFKEL

  Protein domains


Predicted by InterproScan.

TraY domain (TraY)

(14-61)


  Protein structure



No available structure.



ID   567 GenBank   WP_000124826
Name   WP_000124826_FWSEC0430|unnamed3 insolico UniProt ID   _
Length   128 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 128 a.a.        Molecular weight: 14661.78 Da        Isoelectric Point: 4.8581

>WP_000124826.1 MULTISPECIES: conjugal transfer relaxosome DNA-binding protein TraM [Enterobacteriaceae]
MARVILYISNDVYDKVNAIVEKRRQEGARDKEISISGTASMLLELGLRVYEAQMERKESSFNQTEFNKVL
LECVVKTQSSVAKILGIESLSPHIAGNPKFEYANMVEDIREKVSIEMDRFFPKIDNEE

  Protein domains


Predicted by InterproScan.

TraM protein, DNA-binding (Tra_M)

(1-123)


  Protein structure



No available structure.




T4CP

ID   1101 GenBank   WP_100035888
Name   traD_C9205_RS27225_FWSEC0430|unnamed3 insolico UniProt ID   _
Length   726 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 726 a.a.        Molecular weight: 82520.17 Da        Isoelectric Point: 5.0524

>WP_100035888.1 type IV conjugative transfer system coupling protein TraD [Escherichia coli]
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILVGLVLWVKISWQTFINGCIYWWCTTLEGMR
DLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLATVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTENPKDVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYAR
QRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGEPFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLISYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQARPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPDVPEVVSGEDVTQAEQPQQPQQPQQ
PQQPVSSVINDKKSDAGVSVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAAYEAWQQENHPDIQQ
QMQRREEVNINVHRERGEDVEPGDDF

  Protein domains


Predicted by InterproScan.

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(173-560)

F sex factor protein N terminal (TraD_N)

(32-128)

  Protein structure



No available structure.



ID   1102 GenBank   WP_032206659
Name   traC_C9205_RS27365_FWSEC0430|unnamed3 insolico UniProt ID   _
Length   876 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 876 a.a.        Molecular weight: 99484.19 Da        Isoelectric Point: 5.9413

>WP_032206659.1 type IV secretion system protein TraC [Escherichia coli]
MSNNPLEVVTQAVNSLLTALKLPDESAQANQTLGEMNFPQFSRLLPYRDYNQESGLFMNDSTMGFMLEAI
PLNGANETIVEALDHMLRTKLPRGIPLCIHLMSSQLVGERIEYGLREFSWSGEQAERFNAITRAYYMKAA
ETLFPLPEGVNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASFHGAKITTQTVDAQAFIDIV
GEMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAF
LWNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWG
ELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGK
GLFRQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSG
AGKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERIRDQLS
VMASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAESPTIRSRLDEMIVLLDQY
TANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGW
RLLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKY
NQLFPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEG
LSIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

TraG P-loop domain (P-loop_TraG)

(468-771)

TraC protein (TraC_F_IV)

(39-277)

Family of unknown function (DUF5934) (DUF5934)

(290-447)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 27561..59583

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C9205_RS27225 (C9205_27275) 27561..29741 - 2181 WP_100035888 type IV conjugative transfer system coupling protein TraD virb4
C9205_RS27230 (C9205_27280) 29792..30529 - 738 WP_000199895 hypothetical protein -
C9205_RS27235 (C9205_27285) 30697..30957 - 261 WP_001077900 hypothetical protein -
C9205_RS27240 (C9205_27290) 31017..31748 - 732 WP_032207036 conjugal transfer complement resistance protein TraT -
C9205_RS27245 (C9205_27295) 31762..32271 - 510 WP_000628101 conjugal transfer entry exclusion protein TraS -
C9205_RS27250 (C9205_27300) 32268..35114 - 2847 WP_100035889 conjugal transfer mating-pair stabilization protein TraG traG
C9205_RS27255 (C9205_27305) 35111..36484 - 1374 WP_032206680 conjugal transfer pilus assembly protein TraH traH
C9205_RS27260 (C9205_27310) 36471..36863 - 393 WP_032206678 F-type conjugal transfer protein TrbF -
C9205_RS27265 (C9205_27315) 36844..37191 - 348 WP_071532380 P-type conjugative transfer protein TrbJ -
C9205_RS27270 (C9205_27320) 37121..37666 - 546 WP_001457363 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
C9205_RS27275 (C9205_27325) 37653..37943 - 291 WP_032206677 type-F conjugative transfer system pilin chaperone TraQ -
C9205_RS28615 (C9205_27330) 38025..38360 + 336 WP_032206676 hypothetical protein -
C9205_RS27285 (C9205_27335) 38341..38685 - 345 WP_032206675 conjugal transfer protein TrbA -
C9205_RS28360 38689..38772 - 84 Protein_52 hypothetical protein -
C9205_RS27290 (C9205_27340) 38817..39182 - 366 WP_032206674 hypothetical protein -
C9205_RS27295 (C9205_27345) 39196..39939 - 744 WP_021573911 type-F conjugative transfer system pilin assembly protein TraF traF
C9205_RS27300 (C9205_27350) 39932..40189 - 258 WP_032206672 conjugal transfer protein TrbE -
C9205_RS27305 (C9205_27355) 40203..42107 - 1905 WP_050439340 type-F conjugative transfer system mating-pair stabilization protein TraN traN
C9205_RS27310 (C9205_27360) 42201..42581 - 381 WP_032206670 hypothetical protein -
C9205_RS27315 (C9205_27365) 42578..43216 - 639 WP_001035176 type-F conjugative transfer system pilin assembly protein TrbC trbC
C9205_RS27320 (C9205_27370) 43409..43648 + 240 WP_050439339 hypothetical protein -
C9205_RS27325 (C9205_27375) 43645..43824 - 180 WP_000970212 hypothetical protein -
C9205_RS27330 (C9205_27380) 43845..43969 - 125 Protein_61 TraU family protein -
C9205_RS27335 (C9205_27385) 44004..44450 - 447 WP_001289131 hypothetical protein -
C9205_RS27345 (C9205_27395) 45179..45721 - 543 WP_001365589 hypothetical protein -
C9205_RS27350 (C9205_27400) 45735..46727 - 993 WP_000817328 conjugal transfer pilus assembly protein TraU traU
C9205_RS27355 (C9205_27405) 46724..47356 - 633 WP_000877293 type-F conjugative transfer system protein TraW traW
C9205_RS27360 (C9205_27410) 47353..47739 - 387 WP_000214100 type-F conjugative transfer system protein TrbI -
C9205_RS27365 (C9205_27415) 47736..50366 - 2631 WP_032206659 type IV secretion system protein TraC virb4
C9205_RS27370 (C9205_27420) 50497..50844 - 348 WP_000836690 hypothetical protein -
C9205_RS27375 (C9205_27425) 50872..51090 - 219 WP_000556750 hypothetical protein -
C9205_RS27380 (C9205_27430) 51170..51643 - 474 WP_032206656 hypothetical protein -
C9205_RS27385 (C9205_27435) 51636..51857 - 222 WP_001278695 conjugal transfer protein TraR -
C9205_RS27390 (C9205_27440) 51992..52507 - 516 WP_000809870 type IV conjugative transfer system lipoprotein TraV traV
C9205_RS27395 (C9205_27445) 52504..52755 - 252 WP_001038339 conjugal transfer protein TrbG -
C9205_RS27400 (C9205_27450) 52748..53068 - 321 WP_032206653 conjugal transfer protein TrbD virb4
C9205_RS27405 (C9205_27455) 53055..53639 - 585 WP_032206652 conjugal transfer pilus-stabilizing protein TraP -
C9205_RS27410 (C9205_27460) 53629..55059 - 1431 WP_032206651 F-type conjugal transfer pilus assembly protein TraB traB
C9205_RS27415 (C9205_27465) 55059..55787 - 729 WP_021573902 type-F conjugative transfer system secretin TraK traK
C9205_RS27420 (C9205_27470) 55774..56340 - 567 WP_000399759 type IV conjugative transfer system protein TraE traE
C9205_RS27425 (C9205_27475) 56362..56673 - 312 WP_032206649 type IV conjugative transfer system protein TraL traL
C9205_RS27430 (C9205_27480) 56688..57047 - 360 WP_032206647 type IV conjugative transfer system pilin TraA -
C9205_RS27435 (C9205_27485) 57081..57308 - 228 WP_001254389 conjugal transfer relaxosome protein TraY -
C9205_RS27440 (C9205_27490) 57396..58085 - 690 WP_000332474 PAS domain-containing protein -
C9205_RS27445 (C9205_27495) 58274..58660 - 387 WP_000124826 conjugal transfer relaxosome DNA-binding protein TraM -
C9205_RS27450 (C9205_27500) 58936..59583 + 648 WP_136766377 transglycosylase SLT domain-containing protein virB1
C9205_RS27455 (C9205_27505) 59879..60700 - 822 WP_032206646 DUF932 domain-containing protein -
C9205_RS27460 (C9205_27510) 60811..61107 - 297 WP_001272251 hypothetical protein -
C9205_RS27805 (C9205_27515) 61131..61337 - 207 WP_000547959 hypothetical protein -
C9205_RS28365 61407..61580 + 174 Protein_88 hypothetical protein -
C9205_RS27475 (C9205_27525) 61774..61999 - 226 WP_136766376 hypothetical protein -

Host bacterium

ID   2090 GenBank   NZ_RROZ01000128
Plasmid name   FWSEC0430|unnamed3 Incompatibility group   IncFII
Plasmid size   61999 bp Coordinate of oriT [Strand]   58889..59011 [-]
Host baterium   Escherichia coli strain FWSEC0430

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIF11