Detailed information of oriT
oriT
The information of the oriT region
oriTDB ID | 101616 |
Name | oriT_pIEC48020-7 |
Organism | Klebsiella pneumoniae strain KP_IEC48020 |
Sequence Completeness | - |
NCBI accession of oriT (coordinates [strand]) | NZ_JAQLSH010000478 (104109..104158 [-], 50 nt) |
oriT length | 50 nt |
IRs (inverted repeats) | 7..14, 17..24 (GCAAAATT..AATTTTGC) |
Location of nic site | _ |
Conserved sequence flanking the nic site |
_ |
Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 50 nt
>oriT_pIEC48020-7
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGGTATTTTGTGGTGAG
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGGTATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure fileT4CP
ID | 1089 | GenBank | WP_004152630 |
Name | traD_O9C21_RS29780_pIEC48020-7 | UniProt ID | _ |
Length | 769 a.a. | PDB ID | _ |
Note | Predicted by oriTfinder 2.0 |
T4CP protein sequence
Download Length: 769 a.a. Molecular weight: 85951.02 Da Isoelectric Point: 5.0632
>WP_004152630.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSREIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKITEGFIPRRLDTRVDARLSALLEEREAEGSLARALFTPDAPASGPADTDSHAGEQPEPVSQPA
PADMTVSPAPVKAPPTTKMPAAEPSVRATEPPVLRVTTVPLIKPKAAAAAAAASTASSAGIPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSREIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKITEGFIPRRLDTRVDARLSALLEEREAEGSLARALFTPDAPASGPADTDSHAGEQPEPVSQPA
PADMTVSPAPVKAPPTTKMPAAEPSVRATEPPVLRVTTVPLIKPKAAAAAAAASTASSAGIPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 103551..131968
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O9C21_RS29570 (O9C21_29570) | 98568..98918 | + | 351 | WP_004152758 | hypothetical protein | - |
O9C21_RS29575 (O9C21_29575) | 99554..99910 | + | 357 | WP_004152717 | hypothetical protein | - |
O9C21_RS29580 (O9C21_29580) | 99971..100183 | + | 213 | WP_004152718 | hypothetical protein | - |
O9C21_RS29585 (O9C21_29585) | 100194..100418 | + | 225 | WP_004152719 | hypothetical protein | - |
O9C21_RS29590 (O9C21_29590) | 100499..100819 | + | 321 | WP_004152720 | type II toxin-antitoxin system RelE/ParE family toxin | - |
O9C21_RS29595 (O9C21_29595) | 100809..101087 | + | 279 | WP_004152721 | helix-turn-helix transcriptional regulator | - |
O9C21_RS29600 (O9C21_29600) | 101088..101501 | + | 414 | WP_004152722 | helix-turn-helix domain-containing protein | - |
O9C21_RS29605 (O9C21_29605) | 102335..103156 | + | 822 | WP_004178064 | DUF932 domain-containing protein | - |
O9C21_RS29610 (O9C21_29610) | 103189..103518 | + | 330 | WP_011977736 | DUF5983 family protein | - |
O9C21_RS29615 (O9C21_29615) | 103551..104036 | - | 486 | WP_004178063 | transglycosylase SLT domain-containing protein | virB1 |
O9C21_RS29620 (O9C21_29620) | 104470..104861 | + | 392 | Protein_158 | conjugal transfer relaxosome DNA-binding protein TraM | - |
O9C21_RS29625 (O9C21_29625) | 105075..105770 | + | 696 | WP_272050831 | transcriptional regulator TraJ family protein | - |
O9C21_RS29630 (O9C21_29630) | 105854..106225 | + | 372 | WP_004208838 | TraY domain-containing protein | - |
O9C21_RS29635 (O9C21_29635) | 106279..106647 | + | 369 | WP_004178060 | type IV conjugative transfer system pilin TraA | - |
O9C21_RS29640 (O9C21_29640) | 106661..106966 | + | 306 | WP_004178059 | type IV conjugative transfer system protein TraL | traL |
O9C21_RS29645 (O9C21_29645) | 106986..107552 | + | 567 | WP_004152602 | type IV conjugative transfer system protein TraE | traE |
O9C21_RS29650 (O9C21_29650) | 107539..108279 | + | 741 | WP_004152601 | type-F conjugative transfer system secretin TraK | traK |
O9C21_RS29655 (O9C21_29655) | 108279..109703 | + | 1425 | WP_004152600 | F-type conjugal transfer pilus assembly protein TraB | traB |
O9C21_RS29660 (O9C21_29660) | 109696..110292 | + | 597 | WP_004152599 | conjugal transfer pilus-stabilizing protein TraP | - |
O9C21_RS29665 (O9C21_29665) | 110315..110884 | + | 570 | WP_004152598 | type IV conjugative transfer system lipoprotein TraV | traV |
O9C21_RS29670 (O9C21_29670) | 111016..111426 | + | 411 | WP_004152597 | lipase chaperone | - |
O9C21_RS29675 (O9C21_29675) | 111431..111721 | + | 291 | WP_004152596 | hypothetical protein | - |
O9C21_RS29680 (O9C21_29680) | 111745..111963 | + | 219 | WP_004171484 | hypothetical protein | - |
O9C21_RS29685 (O9C21_29685) | 111964..112281 | + | 318 | WP_004152595 | hypothetical protein | - |
O9C21_RS29690 (O9C21_29690) | 112348..112752 | + | 405 | WP_004152594 | hypothetical protein | - |
O9C21_RS29695 (O9C21_29695) | 113048..113446 | + | 399 | WP_004153071 | hypothetical protein | - |
O9C21_RS29700 (O9C21_29700) | 113518..116157 | + | 2640 | WP_004152592 | type IV secretion system protein TraC | virb4 |
O9C21_RS29705 (O9C21_29705) | 116157..116546 | + | 390 | WP_004152591 | type-F conjugative transfer system protein TrbI | - |
O9C21_RS29710 (O9C21_29710) | 116546..117172 | + | 627 | WP_004152590 | type-F conjugative transfer system protein TraW | traW |
O9C21_RS29715 (O9C21_29715) | 117216..118175 | + | 960 | WP_015065634 | conjugal transfer pilus assembly protein TraU | traU |
O9C21_RS29720 (O9C21_29720) | 118188..118826 | + | 639 | WP_004152682 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
O9C21_RS29725 (O9C21_29725) | 118874..120829 | + | 1956 | WP_272050850 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
O9C21_RS29730 (O9C21_29730) | 120861..121097 | + | 237 | WP_004152683 | conjugal transfer protein TrbE | - |
O9C21_RS29990 | 121094..121279 | + | 186 | WP_004152684 | hypothetical protein | - |
O9C21_RS29735 (O9C21_29735) | 121325..121651 | + | 327 | WP_004152685 | hypothetical protein | - |
O9C21_RS29740 (O9C21_29740) | 121672..122424 | + | 753 | WP_004152686 | type-F conjugative transfer system pilin assembly protein TraF | traF |
O9C21_RS29745 (O9C21_29745) | 122435..122674 | + | 240 | WP_004152687 | type-F conjugative transfer system pilin chaperone TraQ | - |
O9C21_RS29750 (O9C21_29750) | 122646..123218 | + | 573 | WP_004152688 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
O9C21_RS29755 (O9C21_29755) | 123211..123639 | + | 429 | WP_004152689 | hypothetical protein | - |
O9C21_RS29760 (O9C21_29760) | 123626..124996 | + | 1371 | WP_004178055 | conjugal transfer pilus assembly protein TraH | traH |
O9C21_RS29765 (O9C21_29765) | 124996..127845 | + | 2850 | WP_004178054 | conjugal transfer mating-pair stabilization protein TraG | traG |
O9C21_RS29770 (O9C21_29770) | 127851..128378 | + | 528 | WP_004153030 | hypothetical protein | - |
O9C21_RS29775 (O9C21_29775) | 128568..129299 | + | 732 | WP_004152629 | conjugal transfer complement resistance protein TraT | - |
O9C21_RS29780 (O9C21_29780) | 129659..131968 | + | 2310 | WP_004152630 | type IV conjugative transfer system coupling protein TraD | virb4 |
Host bacterium
ID | 2060 | GenBank | NZ_JAQLSH010000478 |
Plasmid name | pIEC48020-7 | Incompatibility group | IncFII |
Plasmid size | 144585 bp | Coordinate of oriT [Strand] | 104109..104158 [-] |
Host baterium | Klebsiella pneumoniae strain KP_IEC48020 |
Cargo genes
Drug resistance gene | sul1, qacE |
Virulence gene | - |
Metal resistance gene | arsR, arsD, arsA, arsB, arsC, silP, silA, silB, silF, silC, silR, silS, silE |
Degradation gene | - |
Symbiosis gene | - |
Anti-CRISPR | AcrIE9 |