Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   101616
Name   oriT_pIEC48020-7 in_silico
Organism   Klebsiella pneumoniae strain KP_IEC48020
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_JAQLSH010000478 (104109..104158 [-], 50 nt)
oriT length   50 nt
IRs (inverted repeats)      7..14, 17..24  (GCAAAATT..AATTTTGC)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 50 nt

>oriT_pIEC48020-7
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGGTATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   1089 GenBank   WP_004152630
Name   traD_O9C21_RS29780_pIEC48020-7 insolico UniProt ID   _
Length   769 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 769 a.a.        Molecular weight: 85951.02 Da        Isoelectric Point: 5.0632

>WP_004152630.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSREIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKITEGFIPRRLDTRVDARLSALLEEREAEGSLARALFTPDAPASGPADTDSHAGEQPEPVSQPA
PADMTVSPAPVKAPPTTKMPAAEPSVRATEPPVLRVTTVPLIKPKAAAAAAAASTASSAGIPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF

  Protein domains


Predicted by InterproScan.

(32-128)

(172-560)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 103551..131968

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O9C21_RS29570 (O9C21_29570) 98568..98918 + 351 WP_004152758 hypothetical protein -
O9C21_RS29575 (O9C21_29575) 99554..99910 + 357 WP_004152717 hypothetical protein -
O9C21_RS29580 (O9C21_29580) 99971..100183 + 213 WP_004152718 hypothetical protein -
O9C21_RS29585 (O9C21_29585) 100194..100418 + 225 WP_004152719 hypothetical protein -
O9C21_RS29590 (O9C21_29590) 100499..100819 + 321 WP_004152720 type II toxin-antitoxin system RelE/ParE family toxin -
O9C21_RS29595 (O9C21_29595) 100809..101087 + 279 WP_004152721 helix-turn-helix transcriptional regulator -
O9C21_RS29600 (O9C21_29600) 101088..101501 + 414 WP_004152722 helix-turn-helix domain-containing protein -
O9C21_RS29605 (O9C21_29605) 102335..103156 + 822 WP_004178064 DUF932 domain-containing protein -
O9C21_RS29610 (O9C21_29610) 103189..103518 + 330 WP_011977736 DUF5983 family protein -
O9C21_RS29615 (O9C21_29615) 103551..104036 - 486 WP_004178063 transglycosylase SLT domain-containing protein virB1
O9C21_RS29620 (O9C21_29620) 104470..104861 + 392 Protein_158 conjugal transfer relaxosome DNA-binding protein TraM -
O9C21_RS29625 (O9C21_29625) 105075..105770 + 696 WP_272050831 transcriptional regulator TraJ family protein -
O9C21_RS29630 (O9C21_29630) 105854..106225 + 372 WP_004208838 TraY domain-containing protein -
O9C21_RS29635 (O9C21_29635) 106279..106647 + 369 WP_004178060 type IV conjugative transfer system pilin TraA -
O9C21_RS29640 (O9C21_29640) 106661..106966 + 306 WP_004178059 type IV conjugative transfer system protein TraL traL
O9C21_RS29645 (O9C21_29645) 106986..107552 + 567 WP_004152602 type IV conjugative transfer system protein TraE traE
O9C21_RS29650 (O9C21_29650) 107539..108279 + 741 WP_004152601 type-F conjugative transfer system secretin TraK traK
O9C21_RS29655 (O9C21_29655) 108279..109703 + 1425 WP_004152600 F-type conjugal transfer pilus assembly protein TraB traB
O9C21_RS29660 (O9C21_29660) 109696..110292 + 597 WP_004152599 conjugal transfer pilus-stabilizing protein TraP -
O9C21_RS29665 (O9C21_29665) 110315..110884 + 570 WP_004152598 type IV conjugative transfer system lipoprotein TraV traV
O9C21_RS29670 (O9C21_29670) 111016..111426 + 411 WP_004152597 lipase chaperone -
O9C21_RS29675 (O9C21_29675) 111431..111721 + 291 WP_004152596 hypothetical protein -
O9C21_RS29680 (O9C21_29680) 111745..111963 + 219 WP_004171484 hypothetical protein -
O9C21_RS29685 (O9C21_29685) 111964..112281 + 318 WP_004152595 hypothetical protein -
O9C21_RS29690 (O9C21_29690) 112348..112752 + 405 WP_004152594 hypothetical protein -
O9C21_RS29695 (O9C21_29695) 113048..113446 + 399 WP_004153071 hypothetical protein -
O9C21_RS29700 (O9C21_29700) 113518..116157 + 2640 WP_004152592 type IV secretion system protein TraC virb4
O9C21_RS29705 (O9C21_29705) 116157..116546 + 390 WP_004152591 type-F conjugative transfer system protein TrbI -
O9C21_RS29710 (O9C21_29710) 116546..117172 + 627 WP_004152590 type-F conjugative transfer system protein TraW traW
O9C21_RS29715 (O9C21_29715) 117216..118175 + 960 WP_015065634 conjugal transfer pilus assembly protein TraU traU
O9C21_RS29720 (O9C21_29720) 118188..118826 + 639 WP_004152682 type-F conjugative transfer system pilin assembly protein TrbC trbC
O9C21_RS29725 (O9C21_29725) 118874..120829 + 1956 WP_272050850 type-F conjugative transfer system mating-pair stabilization protein TraN traN
O9C21_RS29730 (O9C21_29730) 120861..121097 + 237 WP_004152683 conjugal transfer protein TrbE -
O9C21_RS29990 121094..121279 + 186 WP_004152684 hypothetical protein -
O9C21_RS29735 (O9C21_29735) 121325..121651 + 327 WP_004152685 hypothetical protein -
O9C21_RS29740 (O9C21_29740) 121672..122424 + 753 WP_004152686 type-F conjugative transfer system pilin assembly protein TraF traF
O9C21_RS29745 (O9C21_29745) 122435..122674 + 240 WP_004152687 type-F conjugative transfer system pilin chaperone TraQ -
O9C21_RS29750 (O9C21_29750) 122646..123218 + 573 WP_004152688 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
O9C21_RS29755 (O9C21_29755) 123211..123639 + 429 WP_004152689 hypothetical protein -
O9C21_RS29760 (O9C21_29760) 123626..124996 + 1371 WP_004178055 conjugal transfer pilus assembly protein TraH traH
O9C21_RS29765 (O9C21_29765) 124996..127845 + 2850 WP_004178054 conjugal transfer mating-pair stabilization protein TraG traG
O9C21_RS29770 (O9C21_29770) 127851..128378 + 528 WP_004153030 hypothetical protein -
O9C21_RS29775 (O9C21_29775) 128568..129299 + 732 WP_004152629 conjugal transfer complement resistance protein TraT -
O9C21_RS29780 (O9C21_29780) 129659..131968 + 2310 WP_004152630 type IV conjugative transfer system coupling protein TraD virb4


Host bacterium


ID   2060 GenBank   NZ_JAQLSH010000478
Plasmid name   pIEC48020-7 Incompatibility group   IncFII
Plasmid size   144585 bp Coordinate of oriT [Strand]   104109..104158 [-]
Host baterium   Klebsiella pneumoniae strain KP_IEC48020

Cargo genes


Drug resistance gene   sul1, qacE
Virulence gene   -
Metal resistance gene   arsR, arsD, arsA, arsB, arsC, silP, silA, silB, silF, silC, silR, silS, silE
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIE9