Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   101612
Name   oriT_pAA337 in_silico
Organism   Escherichia coli strain IITR156
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_JAPRBQ010000154 (17020..17105 [+], 86 nt)
oriT length   86 nt
IRs (inverted repeats)      61..68, 73..80  (TTGGTGGT..ACCACCAA)
 27..34, 37..44  (GCAAAAAC..GTTTTTGC)
 8..13, 21..26  (TGATTT..AAATCA)
Location of nic site      53..54
Conserved sequence flanking the
  nic site    		  GGTGTGGTGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 86 nt

>oriT_pAA337
AATTACATGATTTAAAACGCAAATCAGCAAAAACTTGTTTTTGCGTGGGGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   1087 GenBank   WP_096972255
Name   traC_OWC47_RS25180_pAA337 insolico UniProt ID   _
Length   876 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 876 a.a.        Molecular weight: 99189.80 Da        Isoelectric Point: 6.0793

>WP_096972255.1 type IV secretion system protein TraC [Escherichia coli]
MSNNPLEAVTQTVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNGTTMGFMLEAI
PINGANESIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAA
ATQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASITTQTVDAQAFIDIV
GEIINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAF
LWNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWG
ELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFDLISPRFNHMRNFLTCLPFMAGK
GLFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSG
AGKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLS
VMASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAGSPTIRSRLDEMIVLLDQY
TANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGW
RLLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILRQSAKEFAKY
NQLYPDQFQPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEG
LSIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

TraC protein (TraC_F_IV)

(39-277)

Family of unknown function (DUF5934) (DUF5934)

(290-447)

TraG P-loop domain (P-loop_TraG)

(469-764)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 5..17673

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OWC47_RS25140 (OWC47_25050) 5..1855 - 1851 WP_021517379 type-F conjugative transfer system mating-pair stabilization protein TraN traN
OWC47_RS25145 (OWC47_25055) 1852..2273 - 422 Protein_1 HNH endonuclease signature motif containing protein -
OWC47_RS25150 (OWC47_25060) 2298..2669 - 372 WP_021517381 hypothetical protein -
OWC47_RS25155 (OWC47_25065) 2666..3304 - 639 WP_021517382 type-F conjugative transfer system pilin assembly protein TrbC trbC
OWC47_RS25160 (OWC47_25070) 3313..3618 - 306 WP_021517383 hypothetical protein -
OWC47_RS25165 (OWC47_25075) 3648..4640 - 993 WP_000830838 conjugal transfer pilus assembly protein TraU traU
OWC47_RS25170 (OWC47_25080) 4637..5269 - 633 WP_096928811 type-F conjugative transfer system protein TraW traW
OWC47_RS25175 (OWC47_25085) 5266..5652 - 387 WP_000214084 type-F conjugative transfer system protein TrbI -
OWC47_RS25180 (OWC47_25090) 5649..8279 - 2631 WP_096972255 type IV secretion system protein TraC virb4
OWC47_RS25185 (OWC47_25095) 8405..8767 - 363 WP_021517385 hypothetical protein -
OWC47_RS25190 (OWC47_25100) 8769..9011 - 243 WP_021517386 hypothetical protein -
OWC47_RS25195 (OWC47_25105) 9091..9564 - 474 WP_021517387 hypothetical protein -
OWC47_RS25200 (OWC47_25110) 9557..9970 - 414 WP_000549574 hypothetical protein -
OWC47_RS25205 (OWC47_25115) 9963..10184 - 222 WP_001278695 conjugal transfer protein TraR -
OWC47_RS25210 (OWC47_25120) 10319..10834 - 516 WP_001681800 type IV conjugative transfer system lipoprotein TraV traV
OWC47_RS25215 (OWC47_25125) 10831..11151 - 321 WP_024189401 conjugal transfer protein TrbD -
OWC47_RS25220 (OWC47_25130) 11138..11728 - 591 WP_000002784 conjugal transfer pilus-stabilizing protein TraP -
OWC47_RS25225 (OWC47_25135) 11718..13145 - 1428 WP_021517389 F-type conjugal transfer pilus assembly protein TraB traB
OWC47_RS25230 (OWC47_25140) 13145..13873 - 729 WP_333946431 type-F conjugative transfer system secretin TraK traK
OWC47_RS25235 (OWC47_25145) 13860..14426 - 567 WP_000399801 type IV conjugative transfer system protein TraE traE
OWC47_RS25240 (OWC47_25150) 14448..14759 - 312 WP_000012113 type IV conjugative transfer system protein TraL traL
OWC47_RS25245 (OWC47_25155) 14774..15136 - 363 WP_021517391 type IV conjugative transfer system pilin TraA -
OWC47_RS25250 (OWC47_25160) 15169..15396 - 228 WP_000089265 conjugal transfer relaxosome protein TraY -
OWC47_RS25255 (OWC47_25165) 15521..16174 - 654 WP_021517392 hypothetical protein -
OWC47_RS25260 (OWC47_25170) 16365..16748 - 384 WP_021517393 conjugal transfer relaxosome DNA-binding protein TraM -
OWC47_RS25265 (OWC47_25175) 17083..17673 + 591 WP_231528153 transglycosylase SLT domain-containing protein virB1
OWC47_RS25270 (OWC47_25180) 17970..18791 - 822 WP_001234445 DUF932 domain-containing protein -
OWC47_RS25275 (OWC47_25185) 18902..19198 - 297 WP_021517395 hypothetical protein -
OWC47_RS25280 (OWC47_25190) 19253..19520 + 268 Protein_28 hypothetical protein -
OWC47_RS25285 (OWC47_25195) 19821..19943 - 123 WP_223195199 Hok/Gef family protein -
OWC47_RS25290 (OWC47_25200) 19888..20040 - 153 Protein_30 DUF5431 family protein -
OWC47_RS25295 (OWC47_25205) 20257..20976 - 720 Protein_31 plasmid SOS inhibition protein A -
OWC47_RS25300 (OWC47_25210) 20973..21407 - 435 WP_021517397 conjugation system SOS inhibitor PsiB -

Host bacterium

ID   2056 GenBank   NZ_JAPRBQ010000154
Plasmid name   pAA337 Incompatibility group   -
Plasmid size   24867 bp Coordinate of oriT [Strand]   17020..17105 [+]
Host baterium   Escherichia coli strain IITR156

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -