Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   101584
Name   oriT_pMFDS1016222 in_silico
Organism   Escherichia coli strain MFDS1016222
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_JAQMVE010000003 (65890..66013 [+], 124 nt)
oriT length   124 nt
IRs (inverted repeats)      101..106, 119..124  (TTTAAT..ATTAAA)
 91..99, 113..121  (AATAATGTA..TACATTATT)
 90..95, 107..112  (AAATAA..TTATTT)
 41..48, 61..68  (AAAAACAA..TTGTTTTT)
 39..46, 49..56  (GCAAAAAC..GTTTTTGC)
 3..10, 15..22  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 124 nt

>oriT_pMFDS1016222
GGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTGTTTTTTTAATCATTAGTTTATGTTCTAAATAATGTATTTTAATTTATTTTACATTATTAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein


ID   545 GenBank   WP_032083503
Name   WP_032083503_pMFDS1016222 insolico UniProt ID   _
Length   127 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 127 a.a.        Molecular weight: 14584.63 Da        Isoelectric Point: 5.0278

>WP_032083503.1 conjugal transfer relaxosome DNA-binding protein TraM [Escherichia coli]
MARVNLYISNEVHEKINMIVERRRQEGARDKDISLSGTASMLLELGLRVYDAQMERKESAFNQTEFNKLL
LECVVKTQSTVAKILGIESLSPHVSGNPKFEYASMVDDIREKVSIEMDRFFPKNDDE

  Protein domains


Predicted by InterproScan.

(1-126)


  Protein structure



No available structure.



ID   546 GenBank   WP_001254386
Name   WP_001254386_pMFDS1016222 insolico UniProt ID   A0A3Z6KJB5
Length   75 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 75 a.a.        Molecular weight: 9005.11 Da        Isoelectric Point: 10.1422

>WP_001254386.1 MULTISPECIES: conjugal transfer relaxosome protein TraY [Gammaproteobacteria]
MRRRNARGGISRTVSVYLDEDTNNRLIKAKDRSGRSKTIEVQIRLRDHLKRFPDFYNEEIFREVTEESES
TFKEL

  Protein domains


Predicted by InterproScan.

(14-61)


  Protein structure


Source ID Structure
AlphaFold DB A0A3Z6KJB5


T4CP


ID   1057 GenBank   WP_062873762
Name   traD_V6M04_RS24965_pMFDS1016222 insolico UniProt ID   _
Length   717 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 717 a.a.        Molecular weight: 81434.90 Da        Isoelectric Point: 5.0485

>WP_062873762.1 type IV conjugative transfer system coupling protein TraD [Escherichia coli]
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILVGLVLWVKISWQTFVNGCIYWWCTTLEGMR
DLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLATVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTDNPKDVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYAR
QRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGESFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAASLFDVMNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQTRPKVAPEFIPRDINPDMENRLSAVLAAREAEGRQMASLFEPDVPEVVSGEDVTQAEQPQQPVSPAI
NDKKSDSGVNVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAAYEAWQQENHPDIQQQMQRREEVN
INVHRERGEDVEPGDDF

  Protein domains


Predicted by InterproScan.

(32-128)

(173-560)

  Protein structure



No available structure.



ID   1058 GenBank   WP_001064245
Name   traC_V6M04_RS25445_pMFDS1016222 insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99159.81 Da        Isoelectric Point: 5.8486

>WP_001064245.1 MULTISPECIES: type IV secretion system protein TraC [Enterobacteriaceae]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAAA
TQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASITTQTVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNVADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAESPTIRSRLDEMIVLLDQYT
ANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

(289-446)

(38-276)

(467-771)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 65318..84785

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
V6M04_RS25325 61284..61718 + 435 WP_000845953 conjugation system SOS inhibitor PsiB -
V6M04_RS25330 61715..62477 + 763 Protein_77 plasmid SOS inhibition protein A -
V6M04_RS25335 62446..62634 - 189 WP_032084246 hypothetical protein -
V6M04_RS25340 62656..62805 + 150 Protein_79 plasmid maintenance protein Mok -
V6M04_RS25345 62747..62872 + 126 WP_001372321 type I toxin-antitoxin system Hok family toxin -
V6M04_RS25350 63092..63322 + 231 WP_074014914 hypothetical protein -
V6M04_RS25355 63320..63493 - 174 Protein_82 hypothetical protein -
V6M04_RS25360 63563..63760 + 198 WP_332829938 single-stranded DNA-binding protein -
V6M04_RS25365 63795..64081 + 287 Protein_84 hypothetical protein -
V6M04_RS25370 64200..65021 + 822 WP_074014913 DUF932 domain-containing protein -
V6M04_RS25375 65318..65965 - 648 WP_123007297 transglycosylase SLT domain-containing protein virB1
V6M04_RS25380 66242..66625 + 384 WP_032083503 conjugal transfer relaxosome DNA-binding protein TraM -
V6M04_RS25385 66815..67501 + 687 WP_000332492 PAS domain-containing protein -
V6M04_RS25390 67595..67822 + 228 WP_001254386 conjugal transfer relaxosome protein TraY -
V6M04_RS25395 67856..68221 + 366 WP_332829939 type IV conjugative transfer system pilin TraA -
V6M04_RS25400 68236..68547 + 312 WP_000012106 type IV conjugative transfer system protein TraL traL
V6M04_RS25405 68569..69135 + 567 WP_000399792 type IV conjugative transfer system protein TraE traE
V6M04_RS25410 69122..69850 + 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
V6M04_RS25415 69850..71277 + 1428 WP_000146685 F-type conjugal transfer pilus assembly protein TraB traB
V6M04_RS25420 71267..71857 + 591 WP_000002787 conjugal transfer pilus-stabilizing protein TraP -
V6M04_RS25425 71844..72041 + 198 WP_001324648 conjugal transfer protein TrbD -
V6M04_RS25430 72053..72303 + 251 Protein_97 conjugal transfer protein TrbG -
V6M04_RS25435 72300..72815 + 516 WP_000809838 type IV conjugative transfer system lipoprotein TraV traV
V6M04_RS25440 72950..73171 + 222 WP_001278689 conjugal transfer protein TraR -
V6M04_RS25445 73331..75958 + 2628 WP_001064245 type IV secretion system protein TraC virb4
V6M04_RS25450 75955..76341 + 387 WP_000214096 type-F conjugative transfer system protein TrbI -
V6M04_RS25455 76338..76970 + 633 WP_062873969 type-F conjugative transfer system protein TraW traW
V6M04_RS25460 76967..77959 + 993 WP_021559016 conjugal transfer pilus assembly protein TraU traU
V6M04_RS25465 77968..78606 + 639 WP_282868777 type-F conjugative transfer system pilin assembly protein TrbC trbC
V6M04_RS25470 78603..80411 + 1809 WP_096111975 type-F conjugative transfer system mating-pair stabilization protein TraN traN
V6M04_RS25475 80438..80695 + 258 WP_000864318 conjugal transfer protein TrbE -
V6M04_RS25480 80688..81431 + 744 WP_123010632 type-F conjugative transfer system pilin assembly protein TraF traF
V6M04_RS25485 81447..81794 + 348 WP_032082949 conjugal transfer protein TrbA -
V6M04_RS25490 81796..82071 - 276 WP_001513501 hypothetical protein -
V6M04_RS25495 82152..82436 + 285 WP_000624108 type-F conjugative transfer system pilin chaperone TraQ -
V6M04_RS25500 82423..82968 + 546 WP_000059818 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
V6M04_RS25505 82898..83239 + 342 WP_001442101 P-type conjugative transfer protein TrbJ -
V6M04_RS25510 83226..83618 + 393 WP_282868770 F-type conjugal transfer protein TrbF -
V6M04_RS25515 83605..84785 + 1181 WP_332834651 conjugal transfer pilus assembly protein TraH traH


Host bacterium


ID   2028 GenBank   NZ_JAQMVE010000003
Plasmid name   pMFDS1016222 Incompatibility group   IncFII
Plasmid size   84785 bp Coordinate of oriT [Strand]   65890..66013 [+]
Host baterium   Escherichia coli strain MFDS1016222

Cargo genes


Drug resistance gene   -
Virulence gene   estIa
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -