Detailed information of oriT
oriT
The information of the oriT region
oriTDB ID | 101580 |
Name | oriT_pMFDS1009764 |
Organism | Escherichia coli strain MFDS1009764 |
Sequence Completeness | - |
NCBI accession of oriT (coordinates [strand]) | NZ_JAQMUL010000005 (20009..20132 [-], 124 nt) |
oriT length | 124 nt |
IRs (inverted repeats) | 101..106, 119..124 (TTTAAT..ATTAAA) 91..99, 113..121 (AATAATGTA..TACATTATT) 90..95, 107..112 (AAATAA..TTATTT) 41..48, 61..68 (AAAAACAA..TTGTTTTT) 39..46, 49..56 (GCAAAAAC..GTTTTTGC) 3..10, 15..22 (TTGGTGGT..ACCACCAA) |
Location of nic site | _ |
Conserved sequence flanking the nic site |
_ |
Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 124 nt
GGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTGTTTTTTTAATCATTAGTTTATGTTCTAAATAATGTATTTTAATTTATTTTACATTATTAAA
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure fileAuxiliary protein
ID | 537 | GenBank | WP_001254386 |
Name | WP_001254386_pMFDS1009764 | UniProt ID | A0A3Z6KJB5 |
Length | 75 a.a. | PDB ID | _ |
Note | Predicted by oriTfinder 2.0 |
Auxiliary protein sequence
Download Length: 75 a.a. Molecular weight: 9005.11 Da Isoelectric Point: 10.1422
MRRRNARGGISRTVSVYLDEDTNNRLIKAKDRSGRSKTIEVQIRLRDHLKRFPDFYNEEIFREVTEESES
TFKEL
Protein domains
Predicted by InterproScan.
Protein structure
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z6KJB5 |
ID | 538 | GenBank | WP_040073112 |
Name | WP_040073112_pMFDS1009764 | UniProt ID | _ |
Length | 127 a.a. | PDB ID | _ |
Note | Predicted by oriTfinder 2.0 |
Auxiliary protein sequence
Download Length: 127 a.a. Molecular weight: 14556.62 Da Isoelectric Point: 5.0278
MARVNLYISNEVHEKINMIVEKRRQEGARDKDISLSGTASMLLELGLRVYDAQMERKESAFNQTEFNKLL
LECVVKTQSTVAKILGIESLSPHVSGNPKFEYASMVDDIREKVSIEMDRFFPKNDDE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4CP
ID | 1049 | GenBank | WP_001064245 |
Name | traC_V6L96_RS26235_pMFDS1009764 | UniProt ID | _ |
Length | 875 a.a. | PDB ID | _ |
Note | Predicted by oriTfinder 2.0 |
T4CP protein sequence
Download Length: 875 a.a. Molecular weight: 99159.81 Da Isoelectric Point: 5.8486
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAAA
TQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASITTQTVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNVADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAESPTIRSRLDEMIVLLDQYT
ANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
ID | 1050 | GenBank | WP_062873762 |
Name | traD_V6L96_RS26725_pMFDS1009764 | UniProt ID | _ |
Length | 717 a.a. | PDB ID | _ |
Note | Predicted by oriTfinder 2.0 |
T4CP protein sequence
Download Length: 717 a.a. Molecular weight: 81434.90 Da Isoelectric Point: 5.0485
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILVGLVLWVKISWQTFVNGCIYWWCTTLEGMR
DLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLATVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTDNPKDVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYAR
QRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGESFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAASLFDVMNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQTRPKVAPEFIPRDINPDMENRLSAVLAAREAEGRQMASLFEPDVPEVVSGEDVTQAEQPQQPVSPAI
NDKKSDSGVNVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAAYEAWQQENHPDIQQQMQRREEVN
INVHRERGEDVEPGDDF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 1..20704
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
V6L96_RS26160 | 1..1044 | - | 1044 | WP_332834369 | conjugal transfer protein TraG N-terminal domain-containing protein | traG |
V6L96_RS26165 | 1041..2414 | - | 1374 | WP_000944319 | conjugal transfer pilus assembly protein TraH | traH |
V6L96_RS26170 | 2401..2793 | - | 393 | WP_032082924 | F-type conjugal transfer protein TrbF | - |
V6L96_RS26175 | 2780..3121 | - | 342 | WP_001442101 | P-type conjugative transfer protein TrbJ | - |
V6L96_RS26180 | 3051..3596 | - | 546 | WP_032082911 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
V6L96_RS26185 | 3583..3867 | - | 285 | WP_000624108 | type-F conjugative transfer system pilin chaperone TraQ | - |
V6L96_RS26190 | 3948..4223 | + | 276 | WP_001513501 | hypothetical protein | - |
V6L96_RS26195 | 4225..4572 | - | 348 | WP_032082949 | conjugal transfer protein TrbA | - |
V6L96_RS26200 | 4588..5331 | - | 744 | WP_135460420 | type-F conjugative transfer system pilin assembly protein TraF | traF |
V6L96_RS26205 | 5324..5581 | - | 258 | WP_000864318 | conjugal transfer protein TrbE | - |
V6L96_RS26210 | 5608..7416 | - | 1809 | WP_032082947 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
V6L96_RS26215 | 7413..8051 | - | 639 | WP_000777695 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
V6L96_RS26220 | 8060..9052 | - | 993 | WP_000830183 | conjugal transfer pilus assembly protein TraU | traU |
V6L96_RS26225 | 9049..9681 | - | 633 | WP_001203720 | type-F conjugative transfer system protein TraW | traW |
V6L96_RS26230 | 9678..10064 | - | 387 | WP_032082946 | type-F conjugative transfer system protein TrbI | - |
V6L96_RS26235 | 10061..12688 | - | 2628 | WP_001064245 | type IV secretion system protein TraC | virb4 |
V6L96_RS26240 | 12848..13069 | - | 222 | WP_001278689 | conjugal transfer protein TraR | - |
V6L96_RS26245 | 13204..13719 | - | 516 | WP_000809838 | type IV conjugative transfer system lipoprotein TraV | traV |
V6L96_RS26250 | 13716..13966 | - | 251 | Protein_18 | conjugal transfer protein TrbG | - |
V6L96_RS26255 | 13978..14175 | - | 198 | WP_001324648 | conjugal transfer protein TrbD | - |
V6L96_RS26260 | 14162..14752 | - | 591 | WP_000002787 | conjugal transfer pilus-stabilizing protein TraP | - |
V6L96_RS26265 | 14742..16169 | - | 1428 | WP_000146685 | F-type conjugal transfer pilus assembly protein TraB | traB |
V6L96_RS26270 | 16169..16897 | - | 729 | WP_001230787 | type-F conjugative transfer system secretin TraK | traK |
V6L96_RS26275 | 16884..17450 | - | 567 | WP_000399792 | type IV conjugative transfer system protein TraE | traE |
V6L96_RS26280 | 17472..17783 | - | 312 | WP_000012106 | type IV conjugative transfer system protein TraL | traL |
V6L96_RS26285 | 17798..18164 | - | 367 | Protein_25 | type IV conjugative transfer system pilin TraA | - |
V6L96_RS26290 | 18198..18425 | - | 228 | WP_001254386 | conjugal transfer relaxosome protein TraY | - |
V6L96_RS26295 | 18520..19206 | - | 687 | WP_000332492 | PAS domain-containing protein | - |
V6L96_RS26300 | 19396..19779 | - | 384 | WP_040073112 | conjugal transfer relaxosome DNA-binding protein TraM | - |
V6L96_RS26305 | 20057..20704 | + | 648 | WP_123007297 | transglycosylase SLT domain-containing protein | virB1 |
V6L96_RS26310 | 21001..21822 | - | 822 | WP_074014913 | DUF932 domain-containing protein | - |
V6L96_RS26315 | 21941..22228 | - | 288 | Protein_31 | hypothetical protein | - |
V6L96_RS26320 | 22253..22459 | - | 207 | WP_000547968 | hypothetical protein | - |
V6L96_RS26325 | 22529..22702 | + | 174 | Protein_33 | hypothetical protein | - |
V6L96_RS26330 | 22700..22930 | - | 231 | WP_074014914 | hypothetical protein | - |
V6L96_RS26335 | 23150..23275 | - | 126 | WP_001372321 | type I toxin-antitoxin system Hok family toxin | - |
V6L96_RS26340 | 23217..23366 | - | 150 | Protein_36 | plasmid maintenance protein Mok | - |
V6L96_RS26345 | 23388..23576 | + | 189 | WP_032084246 | hypothetical protein | - |
V6L96_RS26350 | 23545..24307 | - | 763 | Protein_38 | plasmid SOS inhibition protein A | - |
V6L96_RS26355 | 24304..24738 | - | 435 | WP_000845953 | conjugation system SOS inhibitor PsiB | - |
Host bacterium
ID | 2024 | GenBank | NZ_JAQMUL010000005 |
Plasmid name | pMFDS1009764 | Incompatibility group | IncFII |
Plasmid size | 86250 bp | Coordinate of oriT [Strand] | 20009..20132 [-] |
Host baterium | Escherichia coli strain MFDS1009764 |
Cargo genes
Drug resistance gene | - |
Virulence gene | estIa |
Metal resistance gene | - |
Degradation gene | - |
Symbiosis gene | - |
Anti-CRISPR | AcrIIA7 |