Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   101580
Name   oriT_pMFDS1009764 in_silico
Organism   Escherichia coli strain MFDS1009764
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_JAQMUL010000005 (20009..20132 [-], 124 nt)
oriT length   124 nt
IRs (inverted repeats)      101..106, 119..124  (TTTAAT..ATTAAA)
 91..99, 113..121  (AATAATGTA..TACATTATT)
 90..95, 107..112  (AAATAA..TTATTT)
 41..48, 61..68  (AAAAACAA..TTGTTTTT)
 39..46, 49..56  (GCAAAAAC..GTTTTTGC)
 3..10, 15..22  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 124 nt

>oriT_pMFDS1009764
GGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTGTTTTTTTAATCATTAGTTTATGTTCTAAATAATGTATTTTAATTTATTTTACATTATTAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein


ID   537 GenBank   WP_001254386
Name   WP_001254386_pMFDS1009764 insolico UniProt ID   A0A3Z6KJB5
Length   75 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 75 a.a.        Molecular weight: 9005.11 Da        Isoelectric Point: 10.1422

>WP_001254386.1 MULTISPECIES: conjugal transfer relaxosome protein TraY [Gammaproteobacteria]
MRRRNARGGISRTVSVYLDEDTNNRLIKAKDRSGRSKTIEVQIRLRDHLKRFPDFYNEEIFREVTEESES
TFKEL

  Protein domains


Predicted by InterproScan.

(14-61)


  Protein structure


Source ID Structure
AlphaFold DB A0A3Z6KJB5

ID   538 GenBank   WP_040073112
Name   WP_040073112_pMFDS1009764 insolico UniProt ID   _
Length   127 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 127 a.a.        Molecular weight: 14556.62 Da        Isoelectric Point: 5.0278

>WP_040073112.1 conjugal transfer relaxosome DNA-binding protein TraM [Escherichia coli]
MARVNLYISNEVHEKINMIVEKRRQEGARDKDISLSGTASMLLELGLRVYDAQMERKESAFNQTEFNKLL
LECVVKTQSTVAKILGIESLSPHVSGNPKFEYASMVDDIREKVSIEMDRFFPKNDDE

  Protein domains


Predicted by InterproScan.

(1-126)


  Protein structure



No available structure.




T4CP


ID   1049 GenBank   WP_001064245
Name   traC_V6L96_RS26235_pMFDS1009764 insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99159.81 Da        Isoelectric Point: 5.8486

>WP_001064245.1 MULTISPECIES: type IV secretion system protein TraC [Enterobacteriaceae]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAAA
TQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASITTQTVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNVADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAESPTIRSRLDEMIVLLDQYT
ANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

(289-446)

(38-276)

(467-771)

  Protein structure



No available structure.



ID   1050 GenBank   WP_062873762
Name   traD_V6L96_RS26725_pMFDS1009764 insolico UniProt ID   _
Length   717 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 717 a.a.        Molecular weight: 81434.90 Da        Isoelectric Point: 5.0485

>WP_062873762.1 type IV conjugative transfer system coupling protein TraD [Escherichia coli]
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILVGLVLWVKISWQTFVNGCIYWWCTTLEGMR
DLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLATVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTDNPKDVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYAR
QRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGESFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAASLFDVMNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQTRPKVAPEFIPRDINPDMENRLSAVLAAREAEGRQMASLFEPDVPEVVSGEDVTQAEQPQQPVSPAI
NDKKSDSGVNVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAAYEAWQQENHPDIQQQMQRREEVN
INVHRERGEDVEPGDDF

  Protein domains


Predicted by InterproScan.

(32-128)

(173-560)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 1..20704

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
V6L96_RS26160 1..1044 - 1044 WP_332834369 conjugal transfer protein TraG N-terminal domain-containing protein traG
V6L96_RS26165 1041..2414 - 1374 WP_000944319 conjugal transfer pilus assembly protein TraH traH
V6L96_RS26170 2401..2793 - 393 WP_032082924 F-type conjugal transfer protein TrbF -
V6L96_RS26175 2780..3121 - 342 WP_001442101 P-type conjugative transfer protein TrbJ -
V6L96_RS26180 3051..3596 - 546 WP_032082911 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
V6L96_RS26185 3583..3867 - 285 WP_000624108 type-F conjugative transfer system pilin chaperone TraQ -
V6L96_RS26190 3948..4223 + 276 WP_001513501 hypothetical protein -
V6L96_RS26195 4225..4572 - 348 WP_032082949 conjugal transfer protein TrbA -
V6L96_RS26200 4588..5331 - 744 WP_135460420 type-F conjugative transfer system pilin assembly protein TraF traF
V6L96_RS26205 5324..5581 - 258 WP_000864318 conjugal transfer protein TrbE -
V6L96_RS26210 5608..7416 - 1809 WP_032082947 type-F conjugative transfer system mating-pair stabilization protein TraN traN
V6L96_RS26215 7413..8051 - 639 WP_000777695 type-F conjugative transfer system pilin assembly protein TrbC trbC
V6L96_RS26220 8060..9052 - 993 WP_000830183 conjugal transfer pilus assembly protein TraU traU
V6L96_RS26225 9049..9681 - 633 WP_001203720 type-F conjugative transfer system protein TraW traW
V6L96_RS26230 9678..10064 - 387 WP_032082946 type-F conjugative transfer system protein TrbI -
V6L96_RS26235 10061..12688 - 2628 WP_001064245 type IV secretion system protein TraC virb4
V6L96_RS26240 12848..13069 - 222 WP_001278689 conjugal transfer protein TraR -
V6L96_RS26245 13204..13719 - 516 WP_000809838 type IV conjugative transfer system lipoprotein TraV traV
V6L96_RS26250 13716..13966 - 251 Protein_18 conjugal transfer protein TrbG -
V6L96_RS26255 13978..14175 - 198 WP_001324648 conjugal transfer protein TrbD -
V6L96_RS26260 14162..14752 - 591 WP_000002787 conjugal transfer pilus-stabilizing protein TraP -
V6L96_RS26265 14742..16169 - 1428 WP_000146685 F-type conjugal transfer pilus assembly protein TraB traB
V6L96_RS26270 16169..16897 - 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
V6L96_RS26275 16884..17450 - 567 WP_000399792 type IV conjugative transfer system protein TraE traE
V6L96_RS26280 17472..17783 - 312 WP_000012106 type IV conjugative transfer system protein TraL traL
V6L96_RS26285 17798..18164 - 367 Protein_25 type IV conjugative transfer system pilin TraA -
V6L96_RS26290 18198..18425 - 228 WP_001254386 conjugal transfer relaxosome protein TraY -
V6L96_RS26295 18520..19206 - 687 WP_000332492 PAS domain-containing protein -
V6L96_RS26300 19396..19779 - 384 WP_040073112 conjugal transfer relaxosome DNA-binding protein TraM -
V6L96_RS26305 20057..20704 + 648 WP_123007297 transglycosylase SLT domain-containing protein virB1
V6L96_RS26310 21001..21822 - 822 WP_074014913 DUF932 domain-containing protein -
V6L96_RS26315 21941..22228 - 288 Protein_31 hypothetical protein -
V6L96_RS26320 22253..22459 - 207 WP_000547968 hypothetical protein -
V6L96_RS26325 22529..22702 + 174 Protein_33 hypothetical protein -
V6L96_RS26330 22700..22930 - 231 WP_074014914 hypothetical protein -
V6L96_RS26335 23150..23275 - 126 WP_001372321 type I toxin-antitoxin system Hok family toxin -
V6L96_RS26340 23217..23366 - 150 Protein_36 plasmid maintenance protein Mok -
V6L96_RS26345 23388..23576 + 189 WP_032084246 hypothetical protein -
V6L96_RS26350 23545..24307 - 763 Protein_38 plasmid SOS inhibition protein A -
V6L96_RS26355 24304..24738 - 435 WP_000845953 conjugation system SOS inhibitor PsiB -


Host bacterium


ID   2024 GenBank   NZ_JAQMUL010000005
Plasmid name   pMFDS1009764 Incompatibility group   IncFII
Plasmid size   86250 bp Coordinate of oriT [Strand]   20009..20132 [-]
Host baterium   Escherichia coli strain MFDS1009764

Cargo genes


Drug resistance gene   -
Virulence gene   estIa
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA7