Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   101576
Name   oriT_pMFDS1014122 in_silico
Organism   Escherichia coli strain MFDS1014122
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_JAQMUX010000002 (95689..95812 [-], 124 nt)
oriT length   124 nt
IRs (inverted repeats)      92..99, 113..120  (ATAATGTA..TACATTAT)
 90..95, 107..112  (AAATAA..TTATTT)
 39..46, 49..56  (GCAAAAAC..GTTTTTGC)
 3..10, 15..22  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 124 nt

>oriT_pMFDS1014122
GGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTGTATTTAGAATCATCATGTTATGTTTTAAATAATGTATTTTAATTTATTTTACATTATAAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein


ID   531 GenBank   WP_047670840
Name   WP_047670840_pMFDS1014122 insolico UniProt ID   A0A4C9I5X4
Length   75 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 75 a.a.        Molecular weight: 9037.06 Da        Isoelectric Point: 10.0297

>WP_047670840.1 conjugal transfer relaxosome protein TraY [Escherichia coli]
MRRRNARGGTSRTVSVYLDEDTNNRLIRAKDRSGRSKTIEVQIRLRDHLKRYPDFYNEEIFREVTEESES
TFKEL

  Protein domains


Predicted by InterproScan.

(14-61)


  Protein structure


Source ID Structure
AlphaFold DB A0A4C9I5X4

ID   532 GenBank   WP_047671111
Name   WP_047671111_pMFDS1014122 insolico UniProt ID   A0A4D1P4A9
Length   128 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 128 a.a.        Molecular weight: 14608.73 Da        Isoelectric Point: 4.7116

>WP_047671111.1 conjugal transfer relaxosome DNA-binding protein TraM [Escherichia coli]
MARVILYISNDVYDKVNAIVEKRRQEGARDKEISISGTASMLLELGLRVYEAQMECKESSFNQTEFNKVL
LECVVKTQSSVAKILGIESLSPHIAGNPKFEYANMVEDIREKVSIEMDRFFPKIDNEE

  Protein domains


Predicted by InterproScan.

(1-123)


  Protein structure


Source ID Structure
AlphaFold DB A0A4D1P4A9


T4CP


ID   1042 GenBank   WP_135564103
Name   traC_V6M10_RS25835_pMFDS1014122 insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99420.17 Da        Isoelectric Point: 6.0813

>WP_135564103.1 type IV secretion system protein TraC [Escherichia coli]
MNNPLEAVTQAVNSLLTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDITMGFMLEAIP
INGANESIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAAA
TQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASITTQTVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNARDNDQYAESPTIRSRLDEMIVLLDQYT
SNGTYGRYFNSDEPSLRDDARMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNFKKLNVIDEGWR
LLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSIA

  Protein domains


Predicted by InterproScan.

(38-276)

(289-446)

(467-771)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 70100..96384

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
V6M10_RS25700 65498..65848 + 351 WP_000624677 IS66 family insertion sequence element accessory protein TnpB -
V6M10_RS25705 65879..67471 + 1593 WP_000080223 IS66 family transposase -
V6M10_RS25710 67475..67588 - 114 WP_231529310 conjugal transfer protein TraD -
V6M10_RS25715 67644..68361 - 718 Protein_81 hypothetical protein -
V6M10_RS25720 68529..68789 - 261 WP_135564096 hypothetical protein -
V6M10_RS25725 68849..69580 - 732 WP_332832752 conjugal transfer complement resistance protein TraT -
V6M10_RS25730 69594..70103 - 510 WP_332832753 conjugal transfer entry exclusion protein TraS -
V6M10_RS25735 70100..72925 - 2826 WP_332832754 conjugal transfer mating-pair stabilization protein TraG traG
V6M10_RS25740 72922..74295 - 1374 WP_135564106 conjugal transfer pilus assembly protein TraH traH
V6M10_RS25745 74282..74674 - 393 WP_250204681 F-type conjugal transfer protein TrbF -
V6M10_RS25750 74628..74942 - 315 WP_001244894 P-type conjugative transfer protein TrbJ -
V6M10_RS25755 74932..75468 - 537 WP_040091329 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
V6M10_RS25760 75455..75736 - 282 WP_000049684 type-F conjugative transfer system pilin chaperone TraQ -
V6M10_RS25765 76116..76479 - 364 Protein_91 hypothetical protein -
V6M10_RS25770 76493..77236 - 744 WP_040091331 type-F conjugative transfer system pilin assembly protein TraF traF
V6M10_RS25775 77229..77486 - 258 WP_332832755 conjugal transfer protein TrbE -
V6M10_RS25780 77500..78300 - 801 Protein_94 conjugal transfer protein TraN -
V6M10_RS25785 78359..79153 - 795 WP_000544800 IS21-like element helper ATPase IstB -
V6M10_RS25790 79153..80325 - 1173 WP_000952431 IS21-like element ISEc62 family transposase -
V6M10_RS25795 80427..81533 - 1107 Protein_97 conjugal transfer protein TraN -
V6M10_RS25800 81558..81779 + 222 WP_135276000 hypothetical protein -
V6M10_RS25805 81768..82148 - 381 WP_024213661 hypothetical protein -
V6M10_RS25810 82145..82783 - 639 WP_047670815 type-F conjugative transfer system pilin assembly protein TrbC trbC
V6M10_RS25815 82810..83328 - 519 WP_047670817 hypothetical protein -
V6M10_RS25820 83901..84893 - 993 WP_047670819 conjugal transfer pilus assembly protein TraU traU
V6M10_RS25825 84890..85522 - 633 WP_047670821 type-F conjugative transfer system protein TraW traW
V6M10_RS25830 85519..85905 - 387 WP_047670823 type-F conjugative transfer system protein TrbI -
V6M10_RS25835 85902..88529 - 2628 WP_135564103 type IV secretion system protein TraC virb4
V6M10_RS25840 88689..88910 - 222 WP_332832756 conjugal transfer protein TraR -
V6M10_RS25845 89045..89560 - 516 WP_135564104 type IV conjugative transfer system lipoprotein TraV traV
V6M10_RS25850 89557..89877 - 321 WP_135564105 conjugal transfer protein TrbD -
V6M10_RS25855 89864..90451 - 588 WP_047670832 conjugal transfer pilus-stabilizing protein TraP -
V6M10_RS25860 90441..91859 - 1419 WP_047670834 F-type conjugal transfer pilus assembly protein TraB traB
V6M10_RS25865 91859..92587 - 729 WP_001355329 type-F conjugative transfer system secretin TraK traK
V6M10_RS25870 92574..93140 - 567 WP_000399757 type IV conjugative transfer system protein TraE traE
V6M10_RS25875 93162..93473 - 312 WP_000012108 type IV conjugative transfer system protein TraL traL
V6M10_RS25880 93488..93847 - 360 WP_000340268 type IV conjugative transfer system pilin TraA -
V6M10_RS25885 93881..94108 - 228 WP_047670840 conjugal transfer relaxosome protein TraY -
V6M10_RS25890 94196..94885 - 690 WP_000332474 PAS domain-containing protein -
V6M10_RS25895 95075..95461 - 387 WP_047671111 conjugal transfer relaxosome DNA-binding protein TraM -
V6M10_RS25900 95737..96384 + 648 WP_332832772 transglycosylase SLT domain-containing protein virB1
V6M10_RS25905 96681..97502 - 822 WP_332832757 DUF932 domain-containing protein -
V6M10_RS25910 97621..97908 - 288 WP_000107542 hypothetical protein -
V6M10_RS25915 98159..99163 + 1005 WP_332832773 IS110 family transposase -
V6M10_RS25920 99257..99517 - 261 WP_000547943 hypothetical protein -
V6M10_RS25925 100212..100337 - 126 WP_001372321 type I toxin-antitoxin system Hok family toxin -
V6M10_RS25930 100279..100428 - 150 Protein_124 plasmid maintenance protein Mok -
V6M10_RS25935 100450..100638 + 189 WP_032189914 hypothetical protein -
V6M10_RS25940 100583..101369 - 787 Protein_126 plasmid SOS inhibition protein A -


Host bacterium


ID   2020 GenBank   NZ_JAQMUX010000002
Plasmid name   pMFDS1014122 Incompatibility group   IncFIB
Plasmid size   235829 bp Coordinate of oriT [Strand]   95689..95812 [-]
Host baterium   Escherichia coli strain MFDS1014122

Cargo genes


Drug resistance gene   -
Virulence gene   estIa, faeJ, faeI, faeH, faeF, faeE, faeD, faeC, espP
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIF11